BioLiP

>protein
TSHRPQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKSWRKGTAFGRGYINDMTKSEYHQEFLHKHVR

The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7b9v:P	74	73	1.0000	0.9459	0.9589	3.38e-44	6bk8:H, 7dco:S, 6exn:P, 5gm6:S, 5gmk:S, 6j6g:S, 6j6h:S, 6j6n:S, 6j6q:S, 5lj3:P, 5lj5:P, 5mps:P, 5mq0:P, 5wsg:S, 5y88:P, 5ylz:P
2	3jb9:h	90	20	0.1429	0.1111	0.5000	0.017
3	9fmd:P	106	76	0.2429	0.1604	0.2237	0.021	6qdv:P
4	8cs9:g	832	35	0.2143	0.0180	0.4286	0.063	8cs9:V, 8cs9:e, 8cs9:Y, 8cs9:f, 8cs9:Z, 8cte:P, 8cte:T, 7v0k:O, 7v0k:P
5	7tvz:A	850	35	0.2143	0.0176	0.4286	0.063	8crq:C, 8crq:E, 8crr:C, 8crr:E, 8crt:C, 8crt:E, 8ct3:C, 8ct3:E, 8t3r:B, 8t44:B, 8t47:B, 8t47:A, 8t6u:A, 8t6u:B, 8t6v:A, 8t6v:B, 7tvz:B, 7ty4:A, 7ty4:B, 7ty6:A, 7ty6:B, 7ty7:A, 7ty7:B, 7ty8:A, 7ty8:B, 7tya:A, 7tya:B, 7uz3:C, 7uz3:E, 7v07:C, 7v07:E, 7v19:C, 7v19:E
6	8ro0:P	150	20	0.1143	0.0533	0.4000	0.18	8ro1:P
7	6zym:R	87	78	0.2286	0.1839	0.2051	0.19
8	6id0:P	118	20	0.1000	0.0593	0.3500	0.31	8c6j:P, 8ch6:Q, 6ff4:R, 6ff7:R, 8i0s:P, 8i0t:P, 8i0u:P, 8i0v:P, 8i0w:P, 6icz:P, 6id1:P, 5mqf:R, 7qtt:Q, 7w59:P, 7w5a:P, 7w5b:P, 5xjc:P, 5yzg:P, 5z56:P, 5z57:P
9	8ro2:P	112	23	0.1000	0.0625	0.3043	0.31
10	6m6l:B	445	48	0.2286	0.0360	0.3333	0.67
11	8bv5:A	437	17	0.1000	0.0160	0.4118	4.0
12	3va7:A	1130	64	0.2714	0.0168	0.2969	4.2
13	5msd:A	636	23	0.1429	0.0157	0.4348	6.0	5msc:A, 5msq:A

[Back]