TSDIKLLDYLRVRRSTPALQLSEPGPSKGEIEEILRLAVRVPDHGKLAPWRFVVYRGEERVRLSEAALRIALEKNPDLDL
QQQEAERTRFTRAPVVIAVISTAKPHFKIPEWEQVMSAGAVCLNVIFAANASGFAANWLTEWLAFDPAFLAEIGVSAEEK
VAGYIHIGSTTFPPVERPRPELADVVTWVGD
The query sequence (length=191) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3k6h:A | 191 | 191 | 1.0000 | 1.0000 | 1.0000 | 2.85e-139 | 3k6h:B |
2 | 7tmf:B | 183 | 163 | 0.3141 | 0.3279 | 0.3681 | 2.01e-28 | 7tmf:A, 7tmg:A, 7tmg:B |
3 | 3bm1:A | 177 | 174 | 0.3141 | 0.3390 | 0.3448 | 3.10e-27 | 3bm1:B |
4 | 8dil:A | 175 | 169 | 0.3037 | 0.3314 | 0.3432 | 4.48e-25 | 8dil:B, 8dil:C, 8dil:D, 8dil:E, 8dil:F |
5 | 2i7h:A | 187 | 184 | 0.2408 | 0.2460 | 0.2500 | 1.52e-09 | 2i7h:B, 2i7h:C, 2i7h:D |
6 | 3gfa:A | 197 | 184 | 0.2356 | 0.2284 | 0.2446 | 8.39e-07 | 3gfa:B |
7 | 3ek3:A | 187 | 173 | 0.2251 | 0.2299 | 0.2486 | 3.59e-04 | |
8 | 3qdl:A | 178 | 180 | 0.2094 | 0.2247 | 0.2222 | 0.019 | 3qdl:B, 3qdl:C, 3qdl:D |
9 | 4eo3:A | 321 | 200 | 0.2565 | 0.1526 | 0.2450 | 0.12 | 4eo3:B |
10 | 3e10:B | 167 | 107 | 0.1466 | 0.1677 | 0.2617 | 0.13 | 3e10:A |
11 | 2b67:A | 201 | 172 | 0.2094 | 0.1990 | 0.2326 | 0.37 | 2b67:B, 2b67:C, 2b67:D |
12 | 3gr3:A | 226 | 28 | 0.0681 | 0.0575 | 0.4643 | 0.53 | 3gr3:B |
13 | 3ge6:A | 210 | 33 | 0.0733 | 0.0667 | 0.4242 | 0.60 | 3ge6:B |
14 | 7ok0:A | 880 | 88 | 0.1257 | 0.0273 | 0.2727 | 0.69 | 7oq4:A, 7oqy:A |
15 | 3ge5:A | 176 | 155 | 0.1885 | 0.2045 | 0.2323 | 0.85 | 3ge5:B |
16 | 1nox:A | 200 | 42 | 0.0995 | 0.0950 | 0.4524 | 1.2 | |
17 | 7cp7:A | 430 | 49 | 0.0995 | 0.0442 | 0.3878 | 1.3 | 7cp6:A, 7cp6:B |
18 | 8amd:A | 333 | 65 | 0.1099 | 0.0631 | 0.3231 | 1.3 | 8amd:B, 8amd:F, 8amd:G, 8amf:A, 8amf:B, 8amf:F, 8amf:G |
19 | 3kwk:A | 168 | 118 | 0.1466 | 0.1667 | 0.2373 | 1.6 | |
20 | 3e39:A | 175 | 137 | 0.1728 | 0.1886 | 0.2409 | 4.9 | 3e39:B |
21 | 3gbh:B | 213 | 50 | 0.0733 | 0.0657 | 0.2800 | 5.2 | 3gbh:A, 3gbh:C, 3gbh:D |
22 | 2ekp:A | 238 | 120 | 0.1623 | 0.1303 | 0.2583 | 5.5 | |
23 | 7dp0:A | 223 | 197 | 0.2304 | 0.1973 | 0.2234 | 5.8 | 7dp0:B, 7dp1:A, 7dp1:B, 7dp2:A, 7dp2:B |
24 | 8ouw:6 | 707 | 56 | 0.0838 | 0.0226 | 0.2857 | 9.1 | |
25 | 8dos:A | 247 | 41 | 0.0942 | 0.0729 | 0.4390 | 9.3 | 8dos:B |