TSARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPGRRRELLHTEVQNLMARAEY
LKEQVKM
The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4wzx:A | 87 | 87 | 1.0000 | 1.0000 | 1.0000 | 4.79e-56 | |
2 | 4u7y:A | 83 | 78 | 0.3103 | 0.3253 | 0.3462 | 6.87e-07 | 2jqk:A |
3 | 2c6x:A | 363 | 42 | 0.2069 | 0.0496 | 0.4286 | 4.3 | 2c6x:B, 2c6x:C, 2c6x:D |
4 | 7b1f:A | 122 | 35 | 0.1264 | 0.0902 | 0.3143 | 5.4 | 7b1f:B, 7b1h:B, 7b1h:A, 7b1h:E, 7b1h:F, 7b1j:B, 7b1j:A |
5 | 3oaj:A | 310 | 42 | 0.1609 | 0.0452 | 0.3333 | 6.9 | 3oaj:B |
6 | 7r81:S1 | 182 | 25 | 0.1379 | 0.0659 | 0.4800 | 7.6 | |
7 | 1nrj:B | 191 | 24 | 0.0920 | 0.0419 | 0.3333 | 9.6 | |
8 | 1uaa:A | 636 | 59 | 0.1839 | 0.0252 | 0.2712 | 9.8 | 1uaa:B |