TRYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHKRRHIGKRGRKERENSSQNETLKVTCLSNK
EKRHIMHVKKMNQKELAQTSIDTLKLLYDGSPGYSKVFVDANRFDIGDLVKASKLPQRANSRSRDETCESNPFPRLNNPK
KLEPPKILSQWSNTIPKTSIFYSV
The query sequence (length=184) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6n7p:B | 195 | 194 | 0.9946 | 0.9385 | 0.9433 | 2.30e-134 | 6g90:C, 6n7r:B, 6n7x:B, 7oqc:C, 7oqe:C, 5zwn:R |
2 | 8w2o:B | 178 | 183 | 0.8533 | 0.8820 | 0.8579 | 7.84e-115 | |
3 | 2vrd:A | 61 | 50 | 0.1196 | 0.3607 | 0.4400 | 5.73e-09 | 4pjo:L, 4pjo:l, 4pjo:M, 4pjo:m, 6qx9:1C, 7vpx:N |
4 | 8y6o:V | 101 | 51 | 0.0978 | 0.1782 | 0.3529 | 0.008 | |
5 | 5d2r:A | 420 | 104 | 0.1685 | 0.0738 | 0.2981 | 1.4 | 4q6m:A, 4q6n:A, 4q6o:A, 4q6p:A, 4q6q:A, 4wck:A, 4wcl:A, 4wcm:A, 4wcn:A |
6 | 3vm5:A | 499 | 33 | 0.0761 | 0.0281 | 0.4242 | 4.2 | |
7 | 7dvq:v | 119 | 29 | 0.0598 | 0.0924 | 0.3793 | 4.8 | 8y7e:v |
8 | 6g90:T | 462 | 26 | 0.0707 | 0.0281 | 0.5000 | 6.0 | 7dco:u, 4dgw:A, 5nrl:T, 5zwm:u |
9 | 6hiv:A9 | 53 | 16 | 0.0543 | 0.1887 | 0.6250 | 6.1 | 6hix:A9 |
10 | 6bwd:A | 771 | 74 | 0.1359 | 0.0324 | 0.3378 | 8.1 | 6bwd:B, 6bwd:D, 6bwd:C |