TRYLRLKAPFAAFRPFQSGSFRSTTPVPSFSAVYGLLLNLAGIEQRQEVEGKVTLIKPKAELPKLAIAIGQVKPSSTSLI
NQQLHNYPVGNSGKEFASRTFGSKYWIAPVRREVLVNLDLIIGLQSPVEFWQKLDQGLKGENFLFDEIYPIEKPDLASWY
CPLEPDTRPNQGACRLTLWIDRENNTQTTIKVFSPSDFRLEPPAKAWQQLPG
The query sequence (length=212) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ip0:A | 212 | 212 | 1.0000 | 1.0000 | 1.0000 | 3.25e-157 | 8h67:A, 8h7q:A |
2 | 8fcj:A | 212 | 233 | 0.2594 | 0.2594 | 0.2361 | 2.56e-04 | 8fcu:A, 8fd2:A, 8fd3:A, 8ff4:A, 8ff5:A |
3 | 4f32:B | 423 | 40 | 0.0708 | 0.0355 | 0.3750 | 2.3 | 4f32:A |
4 | 8xq7:A | 1041 | 40 | 0.0566 | 0.0115 | 0.3000 | 3.0 | 8xq7:B |
5 | 3ujj:H | 230 | 113 | 0.1132 | 0.1043 | 0.2124 | 4.2 | 6vbo:H |
6 | 2y6s:C | 217 | 62 | 0.0849 | 0.0829 | 0.2903 | 5.1 | 5eoc:L, 5eoc:M, 2gsi:C, 2gsi:G, 2gsi:A, 2gsi:E, 3pho:A, 2y6s:L |
7 | 4hha:B | 226 | 67 | 0.0849 | 0.0796 | 0.2687 | 6.5 | |
8 | 5wnb:H | 226 | 66 | 0.0755 | 0.0708 | 0.2424 | 9.3 | 5wnb:I |