BioLiP

>protein
TRWTPTTEQIKILKELYYNNAIRSPTADQIQKITARLRQFGKIEGKNVFYWFQNHKARE

The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6ryd:A	69	59	1.0000	0.8551	1.0000	1.18e-39	6ryd:B, 6ryd:E, 6ryd:F, 6ryi:A, 6ryi:B, 6ryi:C, 6ryi:D, 6ryi:E, 6ryl:A, 6ryl:B, 6ryl:C, 6ryl:D, 6ryl:E
2	6wig:A	84	59	0.6949	0.4881	0.6949	2.25e-26	6wig:B
3	3q9t:A	577	41	0.2034	0.0208	0.2927	0.99	3q9t:B, 3q9t:C, 5zu2:A, 5zu2:B, 5zu2:C, 5zu3:A, 5zu3:B, 5zu3:C
4	8isk:B	848	19	0.1356	0.0094	0.4211	1.1	8isk:A
5	6ayo:A	229	39	0.2034	0.0524	0.3077	1.6	6ayo:B, 6ayq:A, 6ayq:B, 6ayr:A, 6ayr:B, 6ayr:C, 6ayr:D, 6ays:A, 6ays:B, 6ays:C, 6ays:G, 6ays:D, 6ays:H, 6ays:E, 6ays:F, 6ayt:A, 6ayt:B, 6ayt:C, 6ayt:D
6	5hod:A	61	58	0.3051	0.2951	0.3103	2.5	5hod:D
7	3kpt:B	355	21	0.1525	0.0254	0.4286	4.1
8	5inj:A	355	26	0.1525	0.0254	0.3462	4.8	5k9m:A
9	7w8w:A	346	26	0.1525	0.0260	0.3462	5.2	7w8v:A, 7w8x:A, 7w8y:A
10	2oo0:A	419	22	0.1525	0.0215	0.4091	6.5	5bwa:A, 7odc:A, 2on3:A, 2on3:B, 2oo0:B, 7s3f:A, 7s3f:B, 7s3g:A, 7s3g:B, 7u6p:A, 7u6p:B, 7u6u:A, 7u6u:B, 4zgy:A
11	8iff:A	868	18	0.1186	0.0081	0.3889	6.6	8f5z:B, 8f5z:A, 8iff:B, 8isj:A, 8isj:B
12	1xkq:A	272	44	0.3051	0.0662	0.4091	6.6	1xkq:B, 1xkq:C, 1xkq:D
13	6mat:A	578	38	0.2373	0.0242	0.3684	7.4	6mat:C, 6mat:E, 6mat:B, 6mat:D, 6mat:F, 7swl:A, 7swl:B, 7swl:C, 7swl:D, 7t0v:A, 7t0v:B, 7t0v:C, 7t0v:D, 7t0v:E, 7t0v:F, 7t3i:A, 7t3i:B, 7t3i:C, 7t3i:E, 7t3i:D
14	8ibd:AB	418	49	0.2373	0.0335	0.2857	8.5	8iao:Ab, 8iar:Ab, 8ibd:Ab, 8ibg:AB, 8ibg:Ab
15	3oth:A	395	33	0.1695	0.0253	0.3030	9.6	3otg:A, 3oth:B
16	6tl4:A	496	17	0.1186	0.0141	0.4118	10.0

[Back]