BioLiP

>protein
TRVFKKSSPNGKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTVAFRYGREDCDVLGLSFRKDLFIANYQ
AFPPTPNPPRPPTRLQERLLRKLGQHAHPFFFTIPQNLPSSVTLQPGPEDTGKALGVDFEIRAFVAKSLEEKSHKRNSVR
LVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADIVLFS
TAQYKVPVAQVEQDDQVSPSSTFSKVYTITPFLANNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKV
KLVVSRGGDVSVELPFVLMHPKPH

The query sequence (length=344) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8j8v:A	365	344	1.0000	0.9425	1.0000	0.0	8go9:A, 8go9:F, 8goc:A, 8goc:B, 8goc:C, 8goo:A, 8goo:B, 8goo:C, 8i0z:A, 8i0z:B, 8i0z:C, 8i10:A, 8i10:B, 8i10:C, 8j8r:A, 8j8r:B, 8j8r:C, 8j8v:F, 6k3f:A, 6k3f:B, 6k3f:C, 6k3f:D, 6k3f:E, 6k3f:F, 5tv1:A
2	7dfa:A	363	351	0.8023	0.7603	0.7863	0.0	8as2:A, 8as3:A, 7df9:A, 7dfb:A, 7dfc:A, 8go8:A, 8go8:B, 8gp3:A, 8gp3:B, 8hsv:A, 8hsv:B, 8i0n:B, 8i0n:A, 8i0q:B, 8i0q:A, 8j8z:A, 8j8z:B, 4jqi:A, 8jrv:A, 6ni2:B, 7r0j:C, 6up7:B, 8wrz:A, 1zsh:A
3	8jaf:A	320	343	0.7326	0.7875	0.7347	3.40e-176	8j97:A, 8ja3:B, 8ja3:A
4	7mp1:A	370	351	0.5727	0.5324	0.5613	2.96e-139	7f1w:A, 7f1w:B, 7f1w:D, 7f1x:A, 7f1x:B, 7f1x:C, 7f1x:D, 7jtb:B, 7jtb:C, 7jtb:D, 7jxa:A, 7jxa:B, 7jxa:C, 7jxa:D, 7mor:A, 7mor:B, 7mor:C, 7mor:D, 7mp0:A, 7mp0:D, 7mp0:B, 7mp0:C, 7mp1:B, 7mp1:C, 7mp1:D, 7mp2:A, 7mp2:B, 7mp2:C, 7mp2:D, 3ugx:A, 3ugx:B, 3ugx:C
5	7thq:B	505	42	0.0407	0.0277	0.3333	1.8	6o6e:B, 7thq:A

[Back]