BioLiP

>protein
TRPRVGHIQFLNCLPLYWGLARTGTLLDFELTKDTPEKLSEQLVRGDLDIGPVTLVEFLKNADDLVAFPDIAVGCDGPVM
SCVIVSQVPLDRLDGARVALGSTSRTSVRLAQLLLSERFGVQPDYYTCPPDLSLMMQEADAAVLIGDAALRANMIDGPRY
GLDVHDLGALWKEWTGLPFVFAVWAARRDYAEREPVITRKVHEAFLASRNLSLEEVEKVAEQAARWEAFDEDTLAKFFTT
LDFRFGAPQLEAVTEFARRVGPTTGFPADVKVELLKPL

The query sequence (length=278) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7ahr:B	287	278	0.9964	0.9652	0.9964	0.0	7ahr:A, 7an5:A, 7an5:B, 7an6:A, 7an6:B, 7an7:A, 7an7:B, 7an8:A, 7an8:B, 7an9:A, 7an9:B, 7ywc:A, 7ywc:B
2	6o9a:A	271	269	0.2878	0.2952	0.2974	1.59e-22	6o9a:B
3	3a3u:A	270	209	0.2122	0.2185	0.2823	1.77e-07	2czl:A
4	6g4d:B	453	130	0.1295	0.0795	0.2769	2.2	7b4i:AAA, 7b4i:BBB, 7b4j:A, 7b4j:B, 6g4d:A, 6g4e:A, 6g4e:B, 6g4f:A, 6g4f:B, 6tb0:A, 6tb0:B, 6tb1:A, 6tb1:B
5	7w6u:A	597	43	0.0647	0.0302	0.4186	3.0	7w6r:A, 7xby:A
6	3oi8:A	156	34	0.0540	0.0962	0.4412	3.1	3oi8:B
7	8the:A	712	73	0.0755	0.0295	0.2877	4.1
8	5kr3:A	458	113	0.1007	0.0611	0.2478	4.1	5kr3:B, 5kr4:A, 5kr4:B, 5kr5:A, 5kr5:B
9	6ssy:A	298	143	0.1223	0.1141	0.2378	4.9	6ssy:B, 6st0:A, 6st0:B
10	4xqk:A	1517	92	0.0827	0.0152	0.2500	6.1	4xqk:B
11	8umv:D	329	46	0.0612	0.0517	0.3696	7.1	8ui7:D, 8ui8:D, 8ui9:D, 8uii:D, 8umt:D, 8umw:D, 8umy:D, 8un0:D, 8unj:D, 6vvo:D, 7z6h:D
12	1obf:O	335	39	0.0504	0.0418	0.3590	7.6	1obf:P
13	1jlk:A	141	51	0.0683	0.1348	0.3725	7.8
14	1g4u:S	360	47	0.0612	0.0472	0.3617	9.0
15	4fln:B	464	23	0.0396	0.0237	0.4783	9.3	4fln:A, 4fln:C
16	3lez:A	260	50	0.0576	0.0615	0.3200	9.5
17	5u0l:A	488	100	0.1007	0.0574	0.2800	9.5	5u0m:A, 5u0m:B

[Back]