BioLiP

>protein
TRKMWSVQESEWLKQGVVRYGVGHWERIRSAFPFAGRTAVNLKDRWRTMVKLKMV

The query sequence (length=55) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7c4p:A	55	54	0.9818	0.9818	1.0000	3.57e-35	7c4p:B, 7c4q:A, 7c4q:B, 7c4r:A, 7c4r:B
2	1vfc:A	63	53	0.5273	0.4603	0.5472	4.83e-17	3sjm:A, 3sjm:B, 1w0u:A, 1w0u:B
3	8ox1:M	65	54	0.4727	0.4000	0.4815	2.33e-12	1iv6:A, 8ox1:L, 1w0t:A, 1w0t:B
4	2qhb:A	86	51	0.4000	0.2558	0.4314	5.19e-05	2qhb:B
5	9gd1:W	849	34	0.2909	0.0188	0.4706	0.007
6	7tn2:W	895	34	0.2909	0.0179	0.4706	0.007	9gd2:W, 9gd3:W
7	6ftx:W	878	34	0.2909	0.0182	0.4706	0.008	6g0l:W, 5j70:A, 5j70:B, 3mwy:W, 3ted:A
8	6g0l:M	855	34	0.2909	0.0187	0.4706	0.008	7nkx:W, 5o9g:W
9	3osg:A	110	45	0.3091	0.1545	0.3778	0.013	3osf:A, 3osf:D, 3osg:D
10	8ity:4	365	42	0.2727	0.0411	0.3571	0.013	8iue:4, 8iuh:4
11	8ity:4	365	32	0.2182	0.0329	0.3750	0.052	8iue:4, 8iuh:4
12	7xur:A	307	42	0.2727	0.0489	0.3571	0.016
13	7xur:A	307	32	0.2182	0.0391	0.3750	0.064
14	8ro2:L	555	43	0.2909	0.0288	0.3721	0.060	7abi:L
15	5z56:L	342	43	0.2909	0.0468	0.3721	0.072	5z57:L, 5z58:L
16	6id0:L	475	43	0.2909	0.0337	0.3721	0.075	6id1:L
17	8i0w:L	419	43	0.2909	0.0382	0.3721	0.078	5yzg:L
18	9fmd:L	555	43	0.2909	0.0288	0.3721	0.086	8c6j:O, 7dvq:L, 6ff4:L, 8i0p:L, 8i0r:L, 6zym:L
19	6icz:L	454	43	0.2909	0.0352	0.3721	0.087	5xjc:L
20	1h88:C	152	51	0.2727	0.0987	0.2941	0.091	1h89:C, 1h8a:C, 1mse:C, 1msf:C
21	8ro1:L	623	43	0.2727	0.0241	0.3488	0.14	8ro0:L
22	8ch6:P	330	43	0.2909	0.0485	0.3721	0.15	8i0t:L, 7qtt:P
23	6qdv:O	441	43	0.2909	0.0363	0.3721	0.15	7w59:L, 7w5a:L, 7w5b:L
24	8i0u:L	387	43	0.2909	0.0413	0.3721	0.17	8i0v:L
25	6kks:A	106	38	0.2182	0.1132	0.3158	0.27
26	5mqf:L	336	43	0.2909	0.0476	0.3721	0.30
27	3jb9:W	426	42	0.2909	0.0376	0.3810	0.48
28	7dco:L	435	51	0.2545	0.0322	0.2745	0.63
29	8i0s:L	169	43	0.2909	0.0947	0.3721	0.65
30	6j6g:c	436	51	0.2545	0.0321	0.2745	0.74	6j6h:c, 6j6n:c, 6j6q:c, 5y88:J, 5ylz:J
31	1rcq:A	357	33	0.2182	0.0336	0.3636	1.3
32	6exn:O	320	51	0.2545	0.0437	0.2745	1.4	6bk8:S
33	4ymg:B	239	25	0.1818	0.0418	0.4000	1.5	4ymg:A, 4ymh:A, 4ymh:B, 4ymh:C, 4ymh:D
34	5lj5:O	283	51	0.2545	0.0495	0.2745	2.2
35	7f4l:B	130	36	0.1818	0.0769	0.2778	3.2	7f4m:B, 7f4n:B
36	7edz:B	306	18	0.2000	0.0359	0.6111	3.2	7edz:D, 7edz:C, 7edz:A
37	5gm6:c	415	51	0.2545	0.0337	0.2745	4.3
38	5gmk:c	436	51	0.2545	0.0321	0.2745	4.7	5lj3:O, 5mps:O, 5mq0:O, 5wsg:c
39	7b9v:O	280	51	0.2545	0.0500	0.2745	4.7
40	3zpc:A	357	30	0.1818	0.0280	0.3333	5.0	3zpc:B, 3zpg:A
41	3nks:A	465	21	0.1455	0.0172	0.3810	5.0	4ivm:B, 4ivo:B
42	3b8t:A	359	39	0.1636	0.0251	0.2308	6.5	3b8t:B, 3b8t:C, 3b8t:D, 3b8u:A, 3b8u:B, 3b8u:C, 3b8u:D, 3b8v:A, 3b8v:B, 3b8v:C, 3b8v:D, 3b8w:A, 3b8w:B, 3b8w:C, 3b8w:D, 2rjg:A, 2rjg:B, 2rjg:C, 2rjg:D, 2rjh:A, 2rjh:B, 2rjh:C, 2rjh:D, 4wr3:A, 4wr3:B, 4wr3:C, 4wr3:D, 4xbj:A, 4xbj:B, 4xbj:C, 4xbj:D
43	5nja:D	444	41	0.2545	0.0315	0.3415	7.1	5nja:B
44	6zj3:LZ	217	25	0.2545	0.0645	0.5600	7.4
45	6gsz:A	863	17	0.1455	0.0093	0.4706	7.4
46	8pzk:A	300	11	0.1455	0.0267	0.7273	8.0
47	1rzu:B	478	26	0.1455	0.0167	0.3077	9.0	1rzu:A
48	4ufc:B	788	25	0.1636	0.0114	0.3600	9.5	4ufc:A

[Back]