BioLiP

>protein
TRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVGLMSTPNVAESYQSKFKGRNGLDKVLGDSETTRVKINSVILD
KPHGVATIRFTTVRRVRSNPVDDQPQRWIAIMGYEYKSLAMNAEQRYVNPLGFRVTSYRVNPE

The query sequence (length=143) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5wio:A	143	143	1.0000	1.0000	1.0000	8.70e-106	5wic:B, 5wii:A, 5wip:A
2	4aky:A	134	140	0.4406	0.4701	0.4500	8.71e-36	4aky:B, 4aky:C, 4aky:D, 4aky:E
3	8rta:E	169	140	0.4196	0.3550	0.4286	1.61e-35
4	4nhf:F	143	140	0.3986	0.3986	0.4071	8.92e-34	4nhf:B, 4nhf:C
5	8u19:A	403	31	0.0839	0.0298	0.3871	1.3	8u09:A, 8u1i:A
6	5wkr:A	215	41	0.0839	0.0558	0.2927	1.6	5wks:A
7	2wbv:B	186	35	0.0979	0.0753	0.4000	1.7	2w9l:C, 2w9l:D, 2w9l:E, 2w9l:F, 2w9l:H, 2w9l:I, 2w9l:L, 2w9l:M, 2w9l:N, 2w9l:Q, 2w9l:R, 2w9l:S, 2wbv:D, 2wbv:A, 2wbv:C, 2wbv:E, 2wbv:F
8	1amp:A	291	70	0.1538	0.0756	0.3143	2.7	2anp:A, 3b35:A, 3b3c:A, 3b3s:A, 3b3t:A, 3b3v:A, 3b3w:A, 3b7i:A, 1cp6:A, 2dea:A, 3fh4:A, 1ft7:A, 1igb:A, 2iq6:A, 1lok:A, 2nyq:A, 2prq:A, 1rtq:A, 1txr:A, 3vh9:A, 1xry:A
9	7usw:A	608	67	0.1259	0.0296	0.2687	2.8	7usw:B, 7usx:A, 7usx:B, 7usy:A, 7usy:B
10	5w1j:A	584	42	0.0909	0.0223	0.3095	4.4	5w1j:B, 5w1l:A, 5w1l:B
11	3jck:G	257	25	0.0769	0.0428	0.4400	6.6	3j47:V, 4o8x:B, 4ocl:B, 4ocl:E, 4ocm:B, 4ocm:E, 4owp:B, 5u4p:B, 5w83:B

[Back]