TQPQNMAFRAKATRTARRESQETFWSRFGISQSCGSRFENGENLPFPIYLLLHFYIEGQITDRQLADLRG
The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5j2y:A | 70 | 70 | 1.0000 | 1.0000 | 1.0000 | 1.27e-48 | 5j2y:B |
2 | 3pa1:A | 315 | 42 | 0.1857 | 0.0413 | 0.3095 | 0.40 | 5bsx:A, 5bsy:A, 6gw1:A, 6gw1:B, 6gw2:A, 6gw2:B, 6gy9:A, 6gy9:B, 5hza:A, 5hza:B, 5hzb:B, 5hzb:A, 3ony:A, 3ony:B, 3ony:C, 3pa1:B, 3pa2:A, 3pa2:B, 3q38:A, 3q39:A, 3q39:B, 3q3a:B, 3q3a:A, 3ry8:A, 8y6c:B, 8y6c:A, 8y6d:B, 8y6d:A, 4z4r:A, 4z4r:B, 4z4s:A, 4z4s:B, 4z4t:A, 4z4t:B, 4z4u:A, 4z4u:B, 4z4v:A, 4z4v:B, 4z4w:A, 4z4w:B, 4z4y:A, 4z4z:A, 4z4z:B |
3 | 8tac:B | 66 | 39 | 0.1857 | 0.1970 | 0.3333 | 1.2 | |
4 | 8ch6:V | 285 | 46 | 0.2143 | 0.0526 | 0.3261 | 1.2 | 7qtt:V |
5 | 8i0s:Y | 320 | 46 | 0.2143 | 0.0469 | 0.3261 | 1.4 | 8i0t:Y, 8i0u:Y, 8i0v:Y |
6 | 1pp9:O | 424 | 19 | 0.1429 | 0.0236 | 0.5263 | 7.1 | 2a06:B, 4d6t:B, 4d6t:O, 4d6u:B, 4d6u:O, 7dgq:l, 7dgq:x, 7dgr:l, 7dgr:x, 7dgs:l, 7dgs:x, 6fo0:O, 6fo0:B, 6fo2:O, 6fo2:B, 1pp9:B, 1ppj:O, 1ppj:B, 6qbx:a2, 6qbx:a4, 6qc3:a2, 6qc3:a4, 7tz6:B, 7tz6:O |
7 | 4krg:A | 466 | 23 | 0.1143 | 0.0172 | 0.3478 | 8.9 | 4krg:B |