TQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFEYPGKARNASELRADLEQAMRLIPGPKRLNLHAI
The query sequence (length=401) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
1de5:A |
417 |
416 |
1.0000 |
0.9616 |
0.9639 |
0.0 |
1d8w:A, 1d8w:B, 1d8w:C, 1d8w:D, 1de5:B, 1de5:C, 1de5:D, 1de6:A, 1de6:B, 1de6:C, 1de6:D |
2 |
3uva:C |
405 |
404 |
0.5885 |
0.5827 |
0.5842 |
2.05e-175 |
3uu0:A, 3uu0:B, 3uu0:C, 3uu0:D, 3uva:A, 3uva:B, 3uva:D, 3uxi:A |
3 |
8jq5:B |
421 |
415 |
0.5062 |
0.4822 |
0.4892 |
1.30e-153 |
8jq3:A, 8jq3:B, 8jq3:C, 8jq3:D, 8jq4:A, 8jq4:B, 8jq4:C, 8jq4:D, 8jq5:A, 8jq5:C, 8jq5:D, 8jq6:A, 8jq6:B, 8jq6:C, 8jq6:D |
4 |
5h1w:A |
270 |
109 |
0.0698 |
0.1037 |
0.2569 |
0.17 |
5b7y:A, 5b7y:B, 5b80:A, 5b80:B, 5h1w:B, 5h6h:A, 5h6h:B |
5 |
2fgh:A |
721 |
147 |
0.0973 |
0.0541 |
0.2653 |
0.40 |
3a5l:S, 3a5m:S, 3a5n:S, 3a5o:S, 1c0f:S, 1c0g:S, 4cbu:G, 4cbw:G, 4cbx:G, 3ci5:G, 3cip:G, 3cjb:G, 3cjc:G, 1d4x:G, 1dej:S, 1eqy:S, 1esv:S, 2ff3:A, 2ff6:G, 3ffk:A, 3ffk:D, 2fgh:B, 2fh1:A, 2fh1:B, 2fh1:C, 2fh2:A, 2fh2:B, 2fh2:C, 2fh3:A, 2fh3:B, 2fh3:C, 1h1v:G, 6i4d:G, 6i4e:G, 6i4f:G, 6i4g:G, 6i4g:H, 6i4h:G, 6i4i:G, 6i4j:G, 6i4k:G, 6i4l:G, 6i4m:G, 6lje:A, 6lje:B, 6ljf:A, 6ljf:B, 1mdu:A, 1mdu:D, 5mvv:G, 1nlv:G, 1nm1:G, 1nmd:G, 1nph:A, 1p8x:A, 1p8x:B, 1p8x:C, 1p8z:G, 4pkh:E, 4pkh:J, 1rgi:G, 3tu5:B, 5ubo:S, 1yag:G, 1yvn:G, 5zz0:G, 5zz0:A |
6 |
2p8u:A |
462 |
44 |
0.0374 |
0.0325 |
0.3409 |
1.9 |
2p8u:B |
7 |
2czi:A |
259 |
68 |
0.0549 |
0.0849 |
0.3235 |
3.7 |
2czh:B |
8 |
3slk:A |
747 |
36 |
0.0299 |
0.0161 |
0.3333 |
5.0 |
3slk:B |
9 |
4v4n:AA |
216 |
123 |
0.0748 |
0.1389 |
0.2439 |
7.7 |
4v6u:BA |
10 |
8c61:J |
330 |
50 |
0.0374 |
0.0455 |
0.3000 |
8.5 |
8c61:A, 8c61:D, 8c61:G |
11 |
8ghc:A |
662 |
25 |
0.0274 |
0.0166 |
0.4400 |
8.6 |
8ghb:A, 8ghc:B, 8ghd:A, 8ghd:B, 8ghd:C, 8ghd:D, 8ghd:E, 8ghd:F, 8ghe:B, 8ghe:C, 8ghe:D, 8ghe:A |
12 |
4j5i:E |
250 |
38 |
0.0449 |
0.0720 |
0.4737 |
9.8 |
4j5i:A, 4j5i:D, 4j5i:F, 4j5i:H |