TQACLPVGSRKNGMNVNFYKYSLQDSTTYSDPQYMAYKYSDTKKLGSVSGQTHLSIYYDLNTAFWNTASWSSDLFGFYTT
PTNVTVEMTGYFLPPQTGSYTFKFATVDDSAILSVGGSIAFECCAQEQPPITSTDFTINGIKPWGAAAPTDIKGSTYMYA
GYYYPIKIVYSNAKALARLPVSVVLPDGTEVNDDFEGYVYSFDDDLSQSNCTIPDPS
The query sequence (length=217) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4gq7:A | 220 | 217 | 0.9862 | 0.9727 | 0.9862 | 3.10e-158 | 4lhk:A, 4lhk:B |
2 | 2xjp:A | 258 | 244 | 0.7512 | 0.6318 | 0.6680 | 3.25e-113 | 4lhn:A, 2xjr:A, 2xjs:A, 2xjt:A, 2xju:A, 2xjv:A |
3 | 5a3l:A | 209 | 203 | 0.2903 | 0.3014 | 0.3103 | 3.69e-28 | 5a3l:B, 5a3l:C, 5a3l:D, 5a3m:A, 5a3m:B, 5a3m:C, 5a3m:D |
4 | 6hos:A | 213 | 214 | 0.2903 | 0.2958 | 0.2944 | 1.75e-22 | 6hos:B |
5 | 6y98:A | 225 | 187 | 0.2627 | 0.2533 | 0.3048 | 2.29e-17 | 4cp0:A, 4cp1:A, 4cp2:A |
6 | 4coy:A | 232 | 218 | 0.2949 | 0.2759 | 0.2936 | 2.56e-14 | 4cou:A, 4cov:A, 4cow:A, 4coz:A |
7 | 6y9j:A | 231 | 216 | 0.2673 | 0.2511 | 0.2685 | 4.88e-13 | 4a3x:A, 4af9:A, 4afa:A, 4afb:A, 4afc:A, 4asl:A, 4d3w:A |
8 | 5nrl:U | 196 | 50 | 0.0599 | 0.0663 | 0.2600 | 9.1 |