TPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSIDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSF
HCYGACTKYEYPWHTAKCHYERDYQYETSHGCNPSDCPGVGTGCTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEEN
LCKIIDMNDCFVSRHVKVCIIGTVSKFSQGDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFR
KKCNFATTPICEYDGNMVSGYKKVMATIDSFQSFNTSTMHFTDERIEWKDPDGMLRDHINILVTKDIDFDNLGENPCKIG
LQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIKACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGEDCSQ
IGLHAAAPHL
The query sequence (length=410) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ljz:A | 410 | 410 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 5lk1:A |
2 | 5ljx:A | 382 | 410 | 0.9317 | 1.0000 | 0.9317 | 0.0 | 5lk2:A, 5lk3:A |
3 | 7qqb:B | 423 | 405 | 0.6293 | 0.6099 | 0.6370 | 0.0 | |
4 | 6y62:B | 419 | 407 | 0.6439 | 0.6301 | 0.6486 | 0.0 | 6y5f:B, 6zjm:F, 6zjm:H, 6zjm:D, 6zjm:B |
5 | 7pp2:A | 442 | 48 | 0.0293 | 0.0271 | 0.2500 | 0.41 | |
6 | 2vvf:A | 269 | 83 | 0.0561 | 0.0855 | 0.2771 | 2.0 | 2vvf:B, 2vvf:C, 2vvf:D, 2vvf:E, 2vvf:F, 2w0c:A, 2w0c:B, 2w0c:C, 2w0c:D, 2w0c:E, 2w0c:F, 2w0c:G, 2w0c:H, 2w0c:I, 2w0c:J |
7 | 3fgc:A | 349 | 58 | 0.0366 | 0.0430 | 0.2586 | 4.8 | |
8 | 6jjy:A | 128 | 32 | 0.0268 | 0.0859 | 0.3438 | 6.2 | 6j68:A, 6j68:B, 6j69:A, 6jjw:A, 6jjx:B, 6jjx:A |