TPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPLEEAQSIDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSF
EYPWHTAKCHYERDYTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVSKFSQ
GDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKICEYDGNMVSGYKKVMATIDSFQSFNT
STMHFTDERIEWKDPDGMLRDHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECPTFLTSIKA
CDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGEDCSQIGLHAAAPHL
The query sequence (length=374) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ljx:A | 382 | 385 | 0.9920 | 0.9712 | 0.9636 | 0.0 | 5lk2:A, 5lk3:A |
2 | 5ljz:A | 410 | 410 | 1.0000 | 0.9122 | 0.9122 | 0.0 | 5lk1:A |
3 | 7qqb:B | 423 | 405 | 0.6150 | 0.5437 | 0.5679 | 1.61e-169 | |
4 | 6y62:B | 419 | 407 | 0.6257 | 0.5585 | 0.5749 | 3.98e-167 | 6y5f:B, 6zjm:F, 6zjm:H, 6zjm:D, 6zjm:B |
5 | 7pp2:A | 442 | 60 | 0.0401 | 0.0339 | 0.2500 | 0.20 |