TPVWNDNAHGVGSVPMHTDLELDFSLTSSSKYTYRRKLTNPAQSIDLHIEIEEQTIGVDVHALGHWFDGRLNLKTSFKYE
YPWHTAKCHYERDYQYEGCTACGLYLDQLKPVGSAYKIITIRYSRRVCVQFGEENLCKIIDMNDCFVSRHVKVCIIGTVS
KFSQGDTLLFFGPLEGGGLIFKHWCTSTCQFGDPGDIMSPRDKGFLCPEFPGSFRKKATTPICEYDGNMVSGYKKVMATI
DSFQSFNTSTMHFTDERIEWKDPDGMLRDHINILVTKDIDFDNLGENPCKIGLQTSSIEGAWGSGVGFTLTCLVSLTECP
TFLTSIKACDKAICYGAESVTLTRGQNTVKVSGKGGHSGSTFRCCHGEDCSQIGLHAAAPHL
The query sequence (length=382) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ljx:A | 382 | 382 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 5lk2:A, 5lk3:A |
2 | 5ljz:A | 410 | 410 | 1.0000 | 0.9317 | 0.9317 | 0.0 | 5lk1:A |
3 | 7qqb:B | 423 | 405 | 0.6283 | 0.5674 | 0.5926 | 1.42e-177 | |
4 | 6y62:B | 419 | 407 | 0.6440 | 0.5871 | 0.6044 | 1.72e-176 | 6y5f:B, 6zjm:F, 6zjm:H, 6zjm:D, 6zjm:B |
5 | 7pp2:A | 442 | 65 | 0.0393 | 0.0339 | 0.2308 | 0.34 | |
6 | 2hk1:A | 289 | 76 | 0.0550 | 0.0727 | 0.2763 | 0.40 | 2hk1:B, 2hk1:C, 2hk1:D |
7 | 1frd:A | 98 | 27 | 0.0314 | 0.1224 | 0.4444 | 4.7 |