TPSYSLTPAEASAVAELTLELAAAYGSFGDPVLLRDLPRLAARLPEGVQDFLREFKLADRHGHTVIRGHDFDQRRIGPTP
DHWRGRVRPGPEFPEELLLMLYSALLGEPFGWATQQDGHLVHDIFPIRSHENDQLGMGSKQLLTWHTEDAFHPYRSDYLI
LGALRNPDHVPTTVGELDLSSLSAEDIDVLFEPRYHIAPDESHLPKNNTIATEEEAARFATIQRMIDERPLGPLLYGSRL
DPYMRLDPYFTSVPQDDTDARRAYDALFKVVDSGMREVVADQGDVLFIDNHRAVHGRLPFQARYDGTDRWLKRVCVTSDL
RRSREMRATSATRLLG
The query sequence (length=336) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 4ne0:A | 337 | 336 | 0.9970 | 0.9941 | 0.9970 | 0.0 | 4m25:A, 4m26:A, 4m26:C, 4m26:D, 4m27:A, 4m27:C, 4m27:D, 4m2c:B, 4m2c:C, 4m2c:D, 4m2e:B, 4m2e:C, 4m2e:D, 4m2f:A, 4m2f:C, 4m2f:D, 4m2g:A, 4m2g:C, 4m2g:D, 4m2i:A, 4ne0:C |
| 2 | 4m25:B | 317 | 336 | 0.9405 | 0.9968 | 0.9405 | 0.0 | 4m25:C, 4m25:D, 4m26:B, 4m27:B, 4m2f:B, 4m2g:B, 4m2i:B, 4m2i:C, 4m2i:D, 4ne0:B, 4ne0:D |
| 3 | 6daw:A | 342 | 330 | 0.4435 | 0.4357 | 0.4515 | 1.05e-80 | 6daw:B |
| 4 | 6alm:A | 338 | 333 | 0.4464 | 0.4438 | 0.4505 | 1.08e-77 | 6aln:A, 6alo:A, 6alp:A, 6alq:A, 6alr:A, 6dax:A, 6daz:A, 6db2:A, 9eqf:A, 6mp9:A, 2wbo:A, 2wbp:A, 2wbq:A, 6y0n:A, 6y12:A |
| 5 | 7y5f:B | 341 | 331 | 0.4226 | 0.4164 | 0.4290 | 5.95e-74 | 7vgn:A, 7y5f:A, 7y5i:A, 7y5i:B, 7y5p:A, 7y5p:B, 7yhe:A, 7yhe:B, 7yw9:A |
| 6 | 6mp8:A | 308 | 333 | 0.4196 | 0.4578 | 0.4234 | 2.39e-66 | |
| 7 | 2og6:A | 323 | 271 | 0.2798 | 0.2910 | 0.3469 | 1.01e-30 | 2og7:A |
| 8 | 6euo:C | 354 | 307 | 0.2470 | 0.2345 | 0.2704 | 2.64e-23 | 6euo:A, 6euo:B, 6euo:D, 6eur:A, 6eur:C, 6eur:D, 6exf:A, 6exf:C, 6exf:D, 6exh:A, 6exh:B, 6exh:C, 6exh:D, 6f9p:A, 6f9p:C, 6f9p:D |
| 9 | 6f2a:C | 326 | 332 | 0.2917 | 0.3006 | 0.2952 | 1.57e-22 | 6f2a:A, 6f2a:B, 6f2a:D, 6f2b:A, 6f2b:B, 6f2b:C, 6f2b:D, 6f6j:A, 6f6j:B, 6f6j:C, 6f6j:D |
| 10 | 6eur:B | 328 | 303 | 0.2381 | 0.2439 | 0.2640 | 4.10e-21 | 6exf:B |
| 11 | 1ds1:A | 323 | 286 | 0.2440 | 0.2539 | 0.2867 | 1.85e-16 | 1drt:A, 1dry:A, 1gvg:A |
| 12 | 6vwq:A | 325 | 287 | 0.2440 | 0.2523 | 0.2857 | 2.32e-14 | 6vwr:A |
| 13 | 6f9p:B | 289 | 302 | 0.2024 | 0.2353 | 0.2252 | 3.73e-09 | |
| 14 | 6pbm:A | 426 | 53 | 0.0565 | 0.0446 | 0.3585 | 0.88 | 6c4n:A, 6c4n:B, 6pbm:B, 6pbn:A, 6pbn:B, 6pbp:A, 6pbp:B, 6pbt:A, 6pbt:B |
| 15 | 5hzd:A | 476 | 25 | 0.0327 | 0.0231 | 0.4400 | 2.3 | 5i49:A, 5ido:A |
| 16 | 6bbp:A | 520 | 39 | 0.0417 | 0.0269 | 0.3590 | 2.6 | 2a5d:A, 2a5f:A, 2a5g:A, 6bbq:A, 1e0s:A, 1fgy:A, 1fhw:A, 1fhw:B, 1fhx:A, 1fhx:B, 4fme:C, 4fme:F, 2j5x:A, 2j5x:B, 4kax:A, 4kax:B, 3n5c:A, 3n5c:B, 3pcr:B, 2r09:A, 2r09:B, 2r0d:A, 2r0d:B, 3vhx:A, 3vhx:C, 3vhx:E, 3vhx:G, 2w83:A, 2w83:B, 2w83:E, 7xrd:A, 7xrd:B, 7xrd:C, 7xrd:D |
| 17 | 8chf:A | 280 | 64 | 0.0595 | 0.0714 | 0.3125 | 2.8 | 9ay7:A, 8chf:B, 3omv:A, 3omv:B |
| 18 | 8swj:C | 125 | 40 | 0.0327 | 0.0880 | 0.2750 | 5.2 | 4cri:A, 4cri:B, 8eom:A, 8eom:B, 8f0w:A, 8f0w:B, 2ig0:A, 3lgf:A, 3lgl:A, 3lh0:A, 2lvm:A, 2mwo:A, 2mwp:A, 6mxx:A, 6mxx:B, 6mxx:C, 6mxx:D, 6mxx:E, 6mxx:F, 6mxx:G, 6mxx:H, 6mxx:I, 6mxx:J, 6mxy:A, 6mxy:B, 6mxz:A, 6mxz:B, 6mxz:C, 6mxz:D, 6mxz:E, 6mxz:F, 6mxz:G, 6mxz:H, 6mxz:I, 6mxz:J, 4rg2:A, 4rg2:B, 8swj:A, 8swj:B, 8swj:D, 6upt:A, 6va5:A, 6vip:A, 6vip:B, 4x34:A, 4x34:B |
| 19 | 2q4a:B | 322 | 49 | 0.0476 | 0.0497 | 0.3265 | 6.7 | 2q4a:A, 1y0z:A, 1y0z:B |
| 20 | 7yia:A | 492 | 35 | 0.0446 | 0.0305 | 0.4286 | 7.7 | |
| 21 | 3hft:A | 242 | 123 | 0.0982 | 0.1364 | 0.2683 | 7.8 | |
| 22 | 6u3e:A | 397 | 39 | 0.0387 | 0.0327 | 0.3333 | 9.1 | 6u3e:B, 6u3g:A, 6u3g:B |
umich.edu