TPRGFVVHTAPVGLADDGRDDFTVLASTAPATVSAVFTRSRFAGPSVVLCREAVADGQARGVVVLARNANVATGLEGEEN
AREVREAVARALGLPEGEMLIASTGVIGRQYPMESIREHLKTLEWPAGEGGFDRAARAIMTTDTRPKEVRVSVGGATLVG
IAKGVGMLEPDMA
The query sequence (length=173) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2yep:A | 173 | 173 | 1.0000 | 1.0000 | 1.0000 | 3.73e-122 | 2yep:C |
2 | 3it6:A | 193 | 181 | 0.3584 | 0.3212 | 0.3425 | 1.38e-14 | 3it6:C |
3 | 1u3c:A | 485 | 73 | 0.1214 | 0.0433 | 0.2877 | 0.87 | 1u3d:A |
4 | 1ecx:B | 365 | 82 | 0.1387 | 0.0658 | 0.2927 | 1.9 | 1ecx:A, 1eg5:A, 1eg5:B |
5 | 5c2v:B | 352 | 33 | 0.0809 | 0.0398 | 0.4242 | 2.5 | 5c2v:E, 5c2w:B, 5c2w:E |
6 | 3odh:A | 194 | 35 | 0.0694 | 0.0619 | 0.3429 | 5.9 | 3odh:B, 3odh:E, 3odh:F |