TPPNAPVVTYSDIVNDLIIMQGTAEAKSQLIITDSEGNTYTLTVPDNGKWSMAIPYPSEGKFTITSVDAIGNRSDDVPLD
IMKEVPVISLSPDSDSGTVGDNITRDKQPTFIIGNLESDVVVVQVDINGTVYNAEKNADGVWFFTPGTPLADGSYTISVI
ASDAAGNQKNSLPITVTIDSTLTVPEIALAAGEVTNHTQPKFTLQHIDADVTGVTVNVTHNGVTDIYQATQGADGWTFTP
PAAWNDGNYTLSVTVVDRAGNSQQSASLAVTVD
The query sequence (length=273) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2yn3:C | 284 | 278 | 0.9963 | 0.9577 | 0.9784 | 0.0 | 2yn3:A, 2yn3:B, 2yn3:D, 2yn5:A, 2yn5:B |
2 | 4p99:A | 415 | 232 | 0.2308 | 0.1518 | 0.2716 | 0.006 | 4kdv:A, 4kdw:A, 4p99:B, 4p99:C, 4p99:D |
3 | 4p99:A | 415 | 191 | 0.2015 | 0.1325 | 0.2880 | 0.008 | 4kdv:A, 4kdw:A, 4p99:B, 4p99:C, 4p99:D |
4 | 4p99:A | 415 | 82 | 0.0916 | 0.0602 | 0.3049 | 1.3 | 4kdv:A, 4kdw:A, 4p99:B, 4p99:C, 4p99:D |
5 | 5k8g:A | 511 | 54 | 0.0769 | 0.0411 | 0.3889 | 0.18 | 6x5v:A, 6x5w:A, 6x6m:A, 6x6q:A |
6 | 6bt9:B | 626 | 30 | 0.0549 | 0.0240 | 0.5000 | 0.53 | 6bt9:A |
7 | 7dm0:A | 167 | 76 | 0.0842 | 0.1377 | 0.3026 | 0.76 | 7dm0:B |
8 | 7uww:A | 632 | 51 | 0.0696 | 0.0301 | 0.3725 | 0.95 | 7uwu:A, 7uwu:B, 7uwv:A, 7uww:B |
9 | 3nk3:A | 284 | 88 | 0.0842 | 0.0810 | 0.2614 | 1.5 | 3nk3:B, 3nk4:A, 3nk4:B |
10 | 5irb:B | 314 | 82 | 0.0916 | 0.0796 | 0.3049 | 2.9 | 5irb:A |
11 | 8cmk:A | 913 | 52 | 0.0513 | 0.0153 | 0.2692 | 3.3 | 8cmk:B, 6gx9:A, 6gx9:B |
12 | 8cmk:A | 913 | 28 | 0.0513 | 0.0153 | 0.5000 | 3.6 | 8cmk:B, 6gx9:A, 6gx9:B |
13 | 7biz:A | 478 | 139 | 0.1319 | 0.0753 | 0.2590 | 3.8 | 7biz:B |
14 | 6vjb:A | 1346 | 67 | 0.0769 | 0.0156 | 0.3134 | 4.6 | |
15 | 7edd:A | 1394 | 67 | 0.0769 | 0.0151 | 0.3134 | 4.6 | 5xyr:A |
16 | 5xya:A | 1358 | 67 | 0.0769 | 0.0155 | 0.3134 | 4.8 | 5xxz:A |
17 | 5xxz:B | 1310 | 67 | 0.0769 | 0.0160 | 0.3134 | 5.0 | |
18 | 7mqa:LO | 819 | 80 | 0.0769 | 0.0256 | 0.2625 | 6.6 | |
19 | 3ckg:A | 236 | 154 | 0.1612 | 0.1864 | 0.2857 | 8.9 | |
20 | 6xi3:AAA | 388 | 163 | 0.1575 | 0.1108 | 0.2638 | 9.9 |