TPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYAD
YKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPV
ESSIGKFPRCTTIDFMMYRSIR
The query sequence (length=182) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5a31:L | 182 | 182 | 1.0000 | 1.0000 | 1.0000 | 7.49e-139 | 5g04:L, 6q6h:L |
2 | 8a3t:A | 219 | 135 | 0.2692 | 0.2237 | 0.3630 | 1.70e-27 | |
3 | 6tr4:A | 506 | 65 | 0.1044 | 0.0375 | 0.2923 | 3.9 | 6tr3:A, 6tr4:B |
4 | 6r4o:A | 841 | 26 | 0.0495 | 0.0107 | 0.3462 | 6.4 | |
5 | 5dll:A | 854 | 65 | 0.0714 | 0.0152 | 0.2000 | 7.8 | |
6 | 8wfx:A | 801 | 47 | 0.0934 | 0.0212 | 0.3617 | 8.4 | |
7 | 8hyj:A | 1141 | 38 | 0.0604 | 0.0096 | 0.2895 | 9.2 |