TPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYAD
YKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPV
EESSIGKFPCTTIDFMMYRSIR
The query sequence (length=182) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5a31:L | 182 | 183 | 0.9945 | 0.9945 | 0.9891 | 2.05e-134 | 5g04:L, 6q6h:L |
2 | 8a3t:A | 219 | 135 | 0.2692 | 0.2237 | 0.3630 | 1.56e-27 | |
3 | 6tr4:A | 506 | 65 | 0.1044 | 0.0375 | 0.2923 | 3.7 | 6tr3:A, 6tr4:B |
4 | 5dll:A | 854 | 65 | 0.0714 | 0.0152 | 0.2000 | 7.8 | |
5 | 8wfx:A | 801 | 47 | 0.0934 | 0.0212 | 0.3617 | 8.2 | |
6 | 8hyj:A | 1141 | 38 | 0.0604 | 0.0096 | 0.2895 | 8.6 | |
7 | 1ps9:A | 671 | 64 | 0.0934 | 0.0253 | 0.2656 | 9.7 |