BioLiP

>protein
TNNNQIEQTIFDHKGNVIKTEDREIQIISKFEEPLIVVLGNVLSDEECDELIELSKSKLAAFLDDNELTAKIEKRISSIM
NVPASHGEGLHILNYEVDQQYKAHYDYFAEHSRSAANNRISTLVMYLNDVEEGGETFFPKLNLSVHPRKGMAVYFEYFYQ
DQSLNELTLHGGAPVTKGEKWIATQWVRRGTYK

The query sequence (length=193) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5v7y:A	207	205	0.9689	0.9034	0.9122	7.79e-137	5hv0:A, 5hv0:B, 5hv4:A, 5iav:A, 5iav:B, 5iax:A, 5iax:B, 5v7y:B, 5v7y:D, 5v7y:C
2	2jig:B	195	177	0.3316	0.3282	0.3616	1.09e-32	3gze:B, 3gze:D
3	2jig:A	216	196	0.3472	0.3102	0.3418	1.05e-31	3gze:A, 3gze:C
4	5c5u:B	190	167	0.3005	0.3053	0.3473	1.75e-20	5c5t:A, 5c5t:B, 5c5u:A
5	6tp5:A	370	147	0.2228	0.1162	0.2925	4.61e-11	6tp5:B
6	6tp5:A	370	55	0.0829	0.0432	0.2909	7.4	6tp5:B
7	3jvt:C	156	80	0.1503	0.1859	0.3625	0.21	1b7t:Z, 1dfk:Z, 1dfl:Z, 1dfl:X, 2ec6:C, 1kk7:Z, 1kk8:C, 1kqm:C, 1kwo:C, 1l2o:C, 2os8:C, 2otg:C, 3pn7:C, 3pn7:F, 1qvi:Z, 1s5g:Z, 1scm:C, 1sr6:C, 3ts5:C, 3ts5:F, 3tuy:C, 3tuy:F, 1wdc:C
8	2i99:A	312	65	0.1244	0.0769	0.3692	1.1	4bv9:A, 4bv9:B, 4bva:A, 4bva:B, 2i99:B
9	6jdb:A	290	119	0.1762	0.1172	0.2857	1.4
10	8k0e:A	646	73	0.1088	0.0325	0.2877	2.1	8k0f:A, 8k0m:A, 8k17:A, 8kc9:A
11	3niz:A	288	53	0.0881	0.0590	0.3208	2.1	2qkr:A
12	6jdc:A	269	83	0.1295	0.0929	0.3012	4.2
13	8cip:A	665	59	0.0933	0.0271	0.3051	8.8	8cip:B, 8cip:C, 8cip:D

[Back]