TNAIRNETGTSSKMFNLSKRLYDFKDNNLREIHEALYGLLRAGYDISNMRDVEELAKYVDVKKSHGKLLDVTRDDIELYH
RLFVARFGK
The query sequence (length=89) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8ye9:B | 89 | 89 | 1.0000 | 1.0000 | 1.0000 | 3.95e-61 | |
2 | 4v1z:A | 440 | 48 | 0.1685 | 0.0341 | 0.3125 | 0.49 | 4v20:A |
3 | 5tuk:B | 373 | 33 | 0.1685 | 0.0402 | 0.4545 | 0.60 | 5tuk:A, 5tuk:C, 5tuk:D |
4 | 5wxy:A | 227 | 36 | 0.1348 | 0.0529 | 0.3333 | 1.5 | 5wxz:A, 5xni:A, 5xnj:A, 5xnk:A |
5 | 1mvo:A | 121 | 49 | 0.2022 | 0.1488 | 0.3673 | 1.5 | |
6 | 6pib:A | 245 | 24 | 0.1236 | 0.0449 | 0.4583 | 4.1 | 9eng:A, 6ph9:A, 6pj3:A, 8qk2:A, 8qk5:A, 8qka:A, 7ss6:A, 7ss7:A, 6wii:A |
7 | 8kdb:A | 2117 | 17 | 0.1348 | 0.0057 | 0.7059 | 5.4 | 8kdc:A |
8 | 3vth:A | 753 | 30 | 0.1573 | 0.0186 | 0.4667 | 6.9 | 3vth:B, 3vti:A, 3vti:B |
9 | 6c01:A | 819 | 39 | 0.1685 | 0.0183 | 0.3846 | 6.9 | 6c01:B, 6c02:A, 6c02:B |
10 | 8tzh:A | 1485 | 56 | 0.2135 | 0.0128 | 0.3393 | 9.7 | 3d6t:B |