TMNLNFSLLDEPIPLRGGTILVLEDVCVFSKIVQYCYQYESELKFFDHKMKTIKESEIMLVTDILGFDVNSSTILKLIHA
DLESQFNEKPEVKSMIDKLVATITELIVFECLENELDLEYDEITILELIKSLGVKVETSDTIFEKCLEILQIFKYLTKKK
LLIFVNSGAFLTKDEVASLQEYISLTNLTVLFLEPRELYDFPQYILDEDYFLITKNM
The query sequence (length=217) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3v7f:B | 220 | 220 | 1.0000 | 0.9864 | 0.9864 | 5.79e-151 | 3toc:A, 3toc:B, 3v7f:A |
2 | 3qhq:A | 222 | 219 | 0.7005 | 0.6847 | 0.6941 | 4.21e-106 | 3qhq:B |
3 | 6qxf:B | 219 | 218 | 0.5714 | 0.5662 | 0.5688 | 3.87e-85 | 6qxf:A, 6qxf:C, 6qxf:D, 6qxf:E, 6qxf:F, 6qxf:G, 6qxf:H |
4 | 3s5u:E | 213 | 213 | 0.5438 | 0.5540 | 0.5540 | 3.61e-73 | 3s5u:A, 3s5u:B, 3s5u:C, 3s5u:D, 3s5u:F, 3s5u:G, 3s5u:H |
5 | 1ywq:A | 199 | 70 | 0.0553 | 0.0603 | 0.1714 | 3.6 | |
6 | 4cuk:A | 330 | 68 | 0.1060 | 0.0697 | 0.3382 | 5.8 | 4cuk:D |
7 | 8bob:C | 412 | 41 | 0.0783 | 0.0413 | 0.4146 | 8.6 | 8bob:D |
8 | 4r6g:A | 464 | 49 | 0.0737 | 0.0345 | 0.3265 | 9.6 |