BioLiP

>protein
TMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETV
LKQIREFLEEIVDT

The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3kik:A	94	93	0.9894	0.9894	1.0000	2.42e-63	4c31:B, 4c31:E, 3kik:B, 3kik:D, 3kik:C, 3kjl:A, 3kjl:B, 3kjl:C, 3kjl:D, 4mbe:F, 4mbe:C
2	2a81:A	235	37	0.1277	0.0511	0.3243	1.4
3	5e3x:A	489	32	0.1277	0.0245	0.3750	4.0
4	7mq8:NH	1066	46	0.1596	0.0141	0.3261	4.5	7mqa:NH
5	8v83:b	423	33	0.1277	0.0284	0.3636	4.9	6elz:b, 6em1:b, 6em5:b, 7ohp:b, 7ohr:b, 7ohs:b, 7ohu:b, 7ohv:b, 8v84:b
6	7ohy:b	375	31	0.1170	0.0293	0.3548	5.5
7	6ylg:b	613	33	0.1277	0.0196	0.3636	6.8	7nac:b, 7of1:b, 7r7a:b, 6ylh:b
8	8hfr:rA	647	33	0.1277	0.0185	0.3636	7.2	7bt6:b, 7btb:b, 6c0f:W, 6ft6:b, 3jct:b, 5jcs:o, 6m62:b, 6n8j:b, 6n8k:b, 7nad:b, 7oh3:b, 7ohq:b, 7oht:b, 7r72:b, 7u0h:b, 7ug6:b, 7uoo:b, 7uqb:b, 7uqz:b, 7v08:b, 4v7f:o, 8v87:b, 6ylx:b, 6yly:b, 7z34:b
9	5j6f:A	352	32	0.1064	0.0284	0.3125	7.4	5j6f:B
10	4b7f:A	515	42	0.1170	0.0214	0.2619	7.7	4b7f:B, 4b7f:C, 4b7f:D, 4b7g:A, 4b7g:B, 4b7g:C, 4b7g:D, 4b7h:A, 4b7h:B, 4b7h:C, 4b7h:D
11	6j72:A	561	49	0.1170	0.0196	0.2245	7.9
12	7ohw:b	259	27	0.1170	0.0425	0.4074	8.9
13	7mq8:LO	848	50	0.1489	0.0165	0.2800	9.7	7mq9:LO
14	7mqa:LO	819	50	0.1489	0.0171	0.2800	9.7

[Back]