BioLiP

>protein
TLTTVIDIGNFSTKYAYKDAAQIKVGSFPSILHSYKPLEDYEGMERVEYNGLDYYVGETVKNFYFGREEQMYFGNTRKGH
MEGQIRLVYALYTIFKETGAAEFNLILTCPYESMVTDKKYFVQHFEGEREVIVEGKSFKFTVHNIVMAAEGLGALNFSDS
LNCVIVDAGSKTLNVLYLINGSISKMDSHTINGGTIDNSIMDLAKTFAKTCSNIDYDYPIVCTGGKAEEMKECLENVGYS
TVSSAELGEDKPSYYVNSVGLLLKYGR

The query sequence (length=267) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6bqw:A	275	267	0.9850	0.9564	0.9850	0.0	6bqw:B, 6bqw:C, 6bqw:D, 6bqw:E, 6bqw:F, 6bqw:G, 6bqw:H, 6bqw:I, 6f95:A, 6f95:B, 6f95:C, 6f95:D, 6f95:E
2	7x54:A	285	202	0.2135	0.2000	0.2822	2.95e-09	7x54:B, 7x54:C, 7x54:D, 7x54:E, 7x55:A, 7x55:B, 7x55:C, 7x55:D, 7x55:E, 7x56:A, 7x56:B, 7x56:C, 7x56:D, 7x56:E, 7x59:A, 7x59:B, 7x59:C, 7x59:D, 7x59:E
3	4xhp:A	723	294	0.2360	0.0871	0.2143	0.085
4	6qz4:A	568	167	0.1573	0.0739	0.2515	0.16	8ekg:A, 8ekg:B, 8ekg:C, 8ekg:E, 8ekg:D, 8ekg:F, 6jtt:A, 6jtt:B, 6jtt:C, 6jtu:A, 6jtu:B, 6jtu:C, 6qg9:A, 6qg9:B, 6qg9:C, 6qg9:D, 6qg9:E, 6qg9:F, 6qg9:G, 6qg9:H, 6qg9:I, 6qg9:J, 6qga:A, 6qga:B, 6qga:C, 6qga:D, 6qga:E, 6qga:F, 6qgb:A, 6qgb:B, 6qgb:C, 6qgb:D, 6qgb:E, 6qgb:F, 6qz1:A, 6qz2:A, 6qz2:B, 6qz2:C, 6qz2:D, 6qz2:E, 6qz2:F, 6qz2:G, 6qz2:H, 6qz2:I, 6qz2:J, 6qz3:A, 6qz4:B
5	8r2h:B	701	97	0.1049	0.0399	0.2887	0.30	8r2h:A
6	4xho:A	369	239	0.1985	0.1436	0.2218	4.2	4xe8:A, 4xhn:A
7	1c72:A	217	63	0.0637	0.0783	0.2698	6.0	1c72:B, 1c72:C, 1c72:D, 1gsu:A, 1gsu:B
8	8e56:F	973	121	0.1236	0.0339	0.2727	7.1	8e57:F, 8e58:F, 8eog:D, 8fd7:D, 5gjw:F, 6jp5:F, 6jpa:F, 6jpb:F, 7vfs:B, 7vfu:B, 7vfv:B, 7vfw:B, 7xlq:D, 7yg5:D
9	3eue:A	295	75	0.0824	0.0746	0.2933	9.9	3euf:A, 3euf:B, 3euf:C, 3euf:D, 3nbq:A, 3nbq:B, 3nbq:C, 3nbq:D

[Back]