TLPVFTLEQVAEHHSPDDCWMAIHGKVYDLTPYVPNHPGPAGMMLVWCGQESTEAWETKSYGEPHSSLAARLLQRYLIGT
L
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1cxy:A | 81 | 81 | 1.0000 | 1.0000 | 1.0000 | 8.57e-58 | |
2 | 1awp:A | 86 | 77 | 0.3457 | 0.3256 | 0.3636 | 1.46e-14 | 1awp:B, 1b5m:A, 1eue:A, 1eue:B, 4hil:A, 4hil:B, 1icc:C, 3mus:A |
3 | 3ner:B | 91 | 81 | 0.3457 | 0.3077 | 0.3457 | 2.83e-14 | 3ner:A |
4 | 3ozz:B | 82 | 77 | 0.3457 | 0.3415 | 0.3636 | 8.57e-14 | |
5 | 2ibj:A | 86 | 80 | 0.3210 | 0.3023 | 0.3250 | 1.59e-13 | |
6 | 2i89:A | 90 | 77 | 0.3333 | 0.3000 | 0.3506 | 2.60e-13 | 2i89:B, 2i89:C, 2i89:D, 1icc:A, 1icc:B, 1icc:D, 1lj0:A, 1lj0:B, 1lj0:C, 1lj0:D, 3mus:B |
7 | 4b8n:B | 90 | 53 | 0.2346 | 0.2111 | 0.3585 | 2.67e-12 | 4b8n:A, 4b8n:C, 4b8n:D |
8 | 1aw3:A | 94 | 80 | 0.3333 | 0.2872 | 0.3375 | 5.57e-12 | 1axx:A, 2axx:A, 1b5a:A, 1b5b:A, 1bfx:A, 1blv:A, 1do9:A, 1mny:A |
9 | 1hko:A | 104 | 80 | 0.3210 | 0.2500 | 0.3250 | 6.63e-12 | 1aqa:A, 1cyo:A, 1ehb:A, 1es1:A, 1f03:A, 1f04:A, 1i5u:A, 1ib7:A, 1j0q:A, 1jex:A, 1lqx:A, 1lr6:A, 1m20:A, 1m2i:A, 1m2m:A, 1m59:A, 1nx7:A, 1sh4:A, 1u9m:A, 1u9m:B, 1u9m:C, 1u9m:D, 1u9m:E, 1u9m:F, 1u9u:A, 3x32:A, 3x33:A, 3x34:A, 3x35:A |
10 | 1kbi:A | 504 | 49 | 0.2840 | 0.0456 | 0.4694 | 9.44e-12 | 1fcb:A, 1fcb:B, 1kbi:B, 1kbj:A, 1kbj:B, 3ks0:A, 3ks0:B, 1lco:A, 1lco:B, 1ldc:A, 1ltd:A, 1ltd:B, 2oz0:A, 2oz0:B, 1qcw:A, 1qcw:B, 1sze:A, 1sze:B, 1szf:A, 1szf:B, 1szg:A, 1szg:B |
11 | 2i96:A | 108 | 77 | 0.3086 | 0.2315 | 0.3247 | 5.30e-11 | 4hin:A, 4hin:B, 4hin:C, 4hin:D, 2m33:A |
12 | 3lf5:A | 87 | 52 | 0.2346 | 0.2184 | 0.3654 | 1.58e-09 | 3lf5:B |
13 | 8tgb:A | 108 | 50 | 0.2222 | 0.1667 | 0.3600 | 2.17e-09 | 8tgb:B |
14 | 1x3x:A | 82 | 77 | 0.2716 | 0.2683 | 0.2857 | 3.08e-08 | 1x3x:B |
15 | 1sox:A | 463 | 83 | 0.3580 | 0.0626 | 0.3494 | 9.79e-07 | 2a9a:A, 2a9a:B, 2a9b:A, 2a9c:A, 2a9c:B, 2a9d:A, 2a9d:B, 3hbp:A, 3hbq:A, 1sox:B |
16 | 7bwh:A | 88 | 83 | 0.2716 | 0.2500 | 0.2651 | 3.91e-06 | |
17 | 1mj4:A | 79 | 75 | 0.2716 | 0.2785 | 0.2933 | 6.71e-04 | |
18 | 6vz6:A | 77 | 32 | 0.1605 | 0.1688 | 0.4062 | 0.11 | |
19 | 4x8y:A | 112 | 38 | 0.1728 | 0.1250 | 0.3684 | 0.45 | 4x8y:B |
20 | 6nzx:A | 76 | 83 | 0.2963 | 0.3158 | 0.2892 | 1.4 | |
21 | 6kzb:C | 649 | 76 | 0.2222 | 0.0277 | 0.2368 | 1.7 | |
22 | 7oi6:x | 374 | 18 | 0.1111 | 0.0241 | 0.5000 | 3.1 | |
23 | 5x5h:A | 385 | 85 | 0.2346 | 0.0494 | 0.2235 | 4.5 | |
24 | 5kjq:A | 180 | 44 | 0.1728 | 0.0778 | 0.3182 | 8.8 | 3x2g:A, 3x2h:A, 3x2i:A, 3x2k:A, 3x2l:A, 3x2m:A, 3x2p:A |