TLPDILTFNLDIVIIGIAPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKD
LSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRA
QDKVHYYIKLKDLRDQLKGIE
The query sequence (length=181) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1wyw:A | 216 | 181 | 0.9945 | 0.8333 | 0.9945 | 9.33e-137 | 5cys:A, 5ff8:A, 4fnc:A, 5hf7:A, 4jgc:A, 5jxy:A, 2rba:A, 2rba:B, 5t2w:A, 6u15:A, 6u16:A, 6u17:A, 3ufj:B, 3ufj:A, 3uo7:A, 3uo7:B, 3uob:A, 3uob:B, 4xeg:A, 4z3a:A, 4z47:A, 4z7b:A, 4z7z:A |
2 | 1mwi:A | 165 | 152 | 0.2707 | 0.2970 | 0.3224 | 2.44e-20 | 1mtl:A, 1mtl:B, 1mwj:A |
3 | 3mhh:E | 92 | 50 | 0.0939 | 0.1848 | 0.3400 | 0.033 | 6aqr:E, 4fip:D, 4fip:H, 4fjc:D, 4fk5:E, 3m99:D, 3mhs:E, 6t9l:N, 4wa6:E, 4zux:Y, 4zux:d, 4zux:i, 4zux:n |
4 | 5ifp:A | 968 | 62 | 0.1160 | 0.0217 | 0.3387 | 4.1 | 5ift:A, 5ihr:A, 5juv:A, 5mgc:A, 5mgd:A |
5 | 8atu:A | 2837 | 52 | 0.0829 | 0.0053 | 0.2885 | 4.2 | 8atu:B, 8atx:A, 8atx:B, 8auk:A, 8auk:B, 8auw:B |
6 | 8auw:A | 2900 | 52 | 0.0829 | 0.0052 | 0.2885 | 4.4 | |
7 | 7x4y:E | 459 | 44 | 0.0939 | 0.0370 | 0.3864 | 5.0 | 7x4l:A, 7x4l:F, 7x4l:B, 7x4l:E, 7x4l:C, 7x4l:D, 7x4y:A, 7x4y:C, 7x4y:B, 7x4y:D, 7x4y:F, 7x51:A, 7x51:B, 7x51:C, 7x51:D, 7x51:F, 7x51:E, 7x52:A, 7x52:C, 7x52:B, 7x52:E, 7x52:D, 7x52:F |
8 | 5m1s:D | 229 | 44 | 0.0718 | 0.0568 | 0.2955 | 5.1 | 2gui:A, 2ido:A, 2ido:C, 1j53:A, 1j54:A, 2xy8:A |
9 | 5wtz:A | 420 | 93 | 0.1492 | 0.0643 | 0.2903 | 5.2 | 5h04:A, 5wu0:A |
10 | 1b1x:A | 689 | 21 | 0.0497 | 0.0131 | 0.4286 | 8.8 | 1b7z:A, 3cr9:A, 1f9b:A, 1qjm:A |
11 | 5kis:A | 1446 | 95 | 0.1326 | 0.0166 | 0.2526 | 9.5 |