BioLiP

>protein
TLKASGSTAQANAMTRFVNVFEQACPGQTLNYTANGSGAGISEFNGNQTDFGGSDVPLSKDEAAAAQRRCGSPAWNLPVV
FGPIAVTYNLNSVSSLNLDGPTLAKIFNGSITQWNNPAIQALNRDFTLPGERIHVVFRSDESGTTDNFQRYLQAASNGAW
GKGAGKSFQGGVGEGARGNDGTSAAAKNTPGSITYNEWSFAQAQHLTMANIVTSAGGDPVAITIDSVGQTIAGATISGVG
NDLVLDTDSFYRPKRPGSYPIVLATYEIVCSKYPDSQVGTAVKAFLQSTIGAGQSGLGDNGYIPIPDEFKSRLSTAVNA

The query sequence (length=319) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4lvq:A	319	319	1.0000	1.0000	1.0000	0.0	4lvq:B
2	1a40:A	321	321	0.3072	0.3053	0.3053	1.57e-34	1a54:A, 1a55:A, 2abh:A, 1ixg:A, 1ixh:A, 1ixi:A, 1pbp:A, 1qui:A, 1quj:A, 1quk:A, 1qul:A
3	7dm1:B	334	321	0.3072	0.2934	0.3053	3.33e-19	7dm1:A, 7dm2:A, 1pc3:A, 1pc3:B
4	4f18:A	375	333	0.2884	0.2453	0.2763	4.40e-11	4f19:A, 2q9t:A
5	4m1v:A	378	345	0.2727	0.2302	0.2522	6.95e-06	2v3q:A, 3w9v:A, 3w9v:B, 3w9w:A, 3w9w:B
6	5j1d:A	373	144	0.1223	0.1046	0.2708	0.005	5jk4:A
7	4q8r:A	241	153	0.1223	0.1618	0.2549	0.014
8	1twy:A	249	149	0.1285	0.1647	0.2752	0.093
9	5br4:A	385	69	0.0690	0.0571	0.3188	4.0	2bi4:A, 2bi4:B, 2bl4:A, 2bl4:B, 5br4:B, 7qlg:AAA, 7qlg:BBB, 7qlq:AAA, 7qlq:BBB, 7qls:AAA, 7qls:BBB, 7qnf:AAA, 7qnf:BBB, 7qnh:AAA, 7qnh:BBB, 7qnj:AAA, 7qnj:BBB, 7r0p:AAA, 7r0p:BBB, 7r3d:AAA, 7r3d:BBB, 7r5t:AAA, 7r5t:BBB, 1rrm:A, 1rrm:B

[Back]