Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
TLHKERRIGRLSVLLLLNEQVEELERDGWKVCLGKVGSMDAHKVIAAIETASKKSGVIQSEGYRESHALYHATMEALHGV
TRGEMLLGSLLRTVGLRFAVLRGNPYESEAEGDWIAVSLYGTIGAPIKGLEHETFGVGINHI

The query sequence (length=142) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 3boy:A 147 147 1.0000 0.9660 0.9660 1.43e-98 3boy:B, 3boy:C, 4h4l:A, 4h4l:B, 4h4l:C, 4h4l:D, 4h4l:E, 4h4l:F, 4h4l:G, 4h4l:H, 4h4l:I, 4h4l:J, 4h4l:K, 4h4l:L, 1vea:A, 1vea:B, 1wmq:A, 1wmq:B, 1wpu:A, 1wpu:B, 1wpv:A, 1wpv:C, 1wpv:B, 1wrn:A, 1wrn:C, 1wrn:B, 1wro:A, 1wro:C, 1wro:B, 1wrq:A, 1wrq:B
2 4ok9:A 146 145 0.5775 0.5616 0.5655 2.84e-56 4ok9:B, 4okq:A, 4okq:B
3 6tv0:A 155 50 0.1268 0.1161 0.3600 0.20 6tv0:J, 6tv0:G, 6tv0:I, 6tv0:B, 6tv0:E, 6tv0:C, 6tv0:H, 6tv0:D, 6tv0:F, 4y42:B, 4y42:H, 4y42:I, 4y42:J
4 1ox4:B 538 34 0.0986 0.0260 0.4118 2.6 1jvn:B, 1ox4:A, 1ox5:A, 1ox5:B, 1ox6:B
5 5nci:B 264 80 0.1479 0.0795 0.2625 4.3 5nci:A, 5ncj:A, 5ncj:B
6 4pfq:C 184 56 0.1338 0.1033 0.3393 4.4 4pfq:A, 4pfq:B, 4pfq:D, 4pfq:E, 4pfq:F, 4pfq:G, 4pfq:H
7 2zo4:A 301 59 0.1338 0.0631 0.3220 6.0

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218