TLHKERRIGRLSVLLLLNEAQVEELERDGWKVCLGKVGSMDAHKVIAAIETASKKSGVIQSEGYRESHALYHATMEALHG
VTRGEMLLGSLLRTVGLRFAVLRGNPYESEAEGDWIAVSLYGTIGAPIKGLEHETFGVGINHI
The query sequence (length=143) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3boy:A | 147 | 147 | 1.0000 | 0.9728 | 0.9728 | 2.04e-99 | 3boy:B, 3boy:C, 4h4l:A, 4h4l:B, 4h4l:C, 4h4l:D, 4h4l:E, 4h4l:F, 4h4l:G, 4h4l:H, 4h4l:I, 4h4l:J, 4h4l:K, 4h4l:L, 1vea:A, 1vea:B, 1wmq:A, 1wmq:B, 1wpu:A, 1wpu:B, 1wpv:A, 1wpv:C, 1wpv:B, 1wrn:A, 1wrn:C, 1wrn:B, 1wro:A, 1wro:C, 1wro:B, 1wrq:A, 1wrq:B |
2 | 4ok9:A | 146 | 145 | 0.5874 | 0.5753 | 0.5793 | 1.05e-56 | 4ok9:B, 4okq:A, 4okq:B |
3 | 6tv0:A | 155 | 50 | 0.1259 | 0.1161 | 0.3600 | 0.19 | 6tv0:J, 6tv0:G, 6tv0:I, 6tv0:B, 6tv0:E, 6tv0:C, 6tv0:H, 6tv0:D, 6tv0:F, 4y42:B, 4y42:H, 4y42:I, 4y42:J |
4 | 1ox4:B | 538 | 38 | 0.1049 | 0.0279 | 0.3947 | 1.1 | 1jvn:B, 1ox4:A, 1ox5:A, 1ox5:B, 1ox6:B |
5 | 4pfq:C | 184 | 56 | 0.1329 | 0.1033 | 0.3393 | 4.7 | 4pfq:A, 4pfq:B, 4pfq:D, 4pfq:E, 4pfq:F, 4pfq:G, 4pfq:H |
6 | 2zo4:A | 301 | 59 | 0.1329 | 0.0631 | 0.3220 | 5.8 |