BioLiP

>protein
TKQEKIEKTITFVKHILEKDASGHDWYHIRRVHKMAISLSEQEGGNRFIIEMAALLHDVADLNESEEAGMKKVSDWLEEL
HVEEEESKHVLHIIANMSIEGKLVQDADRLDALGAIGIARTFAYGGAKGRLMYDPTIPPRDPSLNHFYEKLLKLKDLMNT
NAAKQEAEVRHRYMEQFIEQFMKEWNAQ

The query sequence (length=188) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3djb:A	188	188	1.0000	1.0000	1.0000	3.87e-140	3djb:B
2	5dqw:A	188	189	0.4202	0.4202	0.4180	2.86e-44	5dqw:B
3	2qgs:A	209	201	0.4415	0.3971	0.4129	1.01e-43	2qgs:B
4	3b57:A	180	164	0.3936	0.4111	0.4512	3.81e-43
5	2pq7:A	174	177	0.2606	0.2816	0.2768	9.01e-13
6	8wmy:A	198	33	0.0851	0.0808	0.4848	0.49	8wmy:B
7	6oiw:A	504	54	0.0957	0.0357	0.3333	0.59	6oi7:A, 6oi7:B, 6oi7:C, 6oi7:D, 6oi7:E, 6oi7:F, 6oiv:A, 6oiv:B, 6oiv:C, 6oiv:D, 6oiv:E, 6oiv:F, 6oiw:B, 6oiw:C, 6oiw:D, 6oiw:E, 6oiw:F, 6oiy:A, 6oiy:B, 6oiy:C, 6oiy:D, 6oiy:E, 6oiy:F, 4x9e:A, 4x9e:B
8	6oix:C	478	53	0.0957	0.0377	0.3396	0.72	6oix:A, 6oix:B, 6oix:D, 6oix:E, 6oix:F, 7u66:A, 7u66:B, 7u66:C, 7u66:D, 7u66:E, 7u66:F, 7u67:A, 7u67:D, 7u67:C, 7u67:B, 7u67:F, 7u67:E
9	3cir:A	541	105	0.1170	0.0407	0.2095	1.2
10	3nqw:A	178	72	0.1170	0.1236	0.3056	4.5	3nqw:B
11	2ogi:B	194	33	0.0745	0.0722	0.4242	4.5	2ogi:A
12	5d6j:A	630	67	0.1117	0.0333	0.3134	4.6	5ey8:A, 5ey8:B, 5ey8:C, 5ey8:D, 5ey8:E, 5ey8:F, 5ey8:G, 5ey8:H, 5icr:A, 5icr:B, 5icr:C, 5icr:D
13	4ipn:E	463	60	0.1117	0.0454	0.3500	5.5	4ipn:B
14	7xnt:C	320	43	0.0585	0.0344	0.2558	6.1
15	2o08:A	187	44	0.0745	0.0749	0.3182	6.1	2o08:B
16	3l0q:A	541	30	0.0798	0.0277	0.5000	6.1
17	4v5o:AM	154	43	0.0798	0.0974	0.3488	6.4	4bts:AM, 4bts:BM, 4bts:CM, 4bts:DM, 4v5o:BM
18	3pju:A	249	107	0.1383	0.1044	0.2430	9.8	3pjt:A, 3pjt:B

[Back]