TKIYRCKLTLHDNVFFASREMGILYETEKYFHNWALSYAFFKGTIIPHPYGLVGQNAQTPAYLDRDREQNLLHLNDSGIY
VFPAQPIHWSYQINTFKAAQSAYYGRSVQFGGKGATKNYPINYGRAKELAVGSEFLTYIVSQKELDLPVWIRLGKWSSKI
RVEVEAIAPDQIKTASGVYVCNHPLNPLDCPANQQILLYNRVVMPPSSLFSQSQLQGDYWQIDRNTFLPQGFHYGATT
The query sequence (length=238) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7sba:H | 238 | 238 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7sbb:H |
2 | 3dg6:A | 366 | 37 | 0.0630 | 0.0410 | 0.4054 | 1.5 | 3dg3:A, 3dg7:A, 3dg7:B, 3dg7:C, 3dg7:D |
3 | 1u9k:A | 110 | 65 | 0.0840 | 0.1818 | 0.3077 | 2.3 | 1u9k:B |
4 | 7b9v:o | 330 | 39 | 0.0630 | 0.0455 | 0.3846 | 3.2 | 6bk8:M, 6exn:o, 5mps:o, 5mq0:o |
5 | 7t5t:A | 278 | 48 | 0.0630 | 0.0540 | 0.3125 | 7.9 | |
6 | 2xcu:A | 353 | 58 | 0.0924 | 0.0623 | 0.3793 | 8.2 | 2xcu:B, 2xcu:C, 2xcu:D |