TKDRHTKVEGRGRRIRMPAMCAARVFQLTRELGHKSDGETIEWLLQQAEPAVIAATGTGTIP
The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7vp3:C | 62 | 62 | 1.0000 | 1.0000 | 1.0000 | 2.41e-41 | 7vp3:D, 7vp3:J, 7vp3:G, 7vp3:L, 7vp3:I, 7vp3:N, 7vp3:P |
2 | 7vp2:A | 83 | 55 | 0.3065 | 0.2289 | 0.3455 | 5.15e-06 | 7vp1:A, 7vp1:B, 7vp2:B, 7vp4:B, 7vp4:A, 7vp4:F, 7vp4:E, 7vp4:J, 7vp4:I, 7vp5:A, 7vp5:B, 7vp5:E, 7vp5:F, 7vp5:I, 7vp5:J, 7vp7:A, 7vp7:B |
3 | 5k3i:A | 661 | 26 | 0.2258 | 0.0212 | 0.5385 | 0.036 | 5k3i:B, 5k3i:C, 5k3i:D, 5k3i:E, 5k3i:F, 5k3i:G, 5k3i:H |
4 | 7jrq:A | 127 | 39 | 0.1935 | 0.0945 | 0.3077 | 0.32 | |
5 | 8jg2:A | 393 | 32 | 0.2258 | 0.0356 | 0.4375 | 0.82 | 8jg2:B |
6 | 4lrt:B | 295 | 20 | 0.1452 | 0.0305 | 0.4500 | 2.2 | 4lrs:B, 4lrt:D |
7 | 5et1:A | 331 | 51 | 0.2419 | 0.0453 | 0.2941 | 2.2 | 5et0:A, 5et0:C, 5et1:B |
8 | 5hwn:B | 310 | 21 | 0.1613 | 0.0323 | 0.4762 | 5.8 | 5hwm:A, 5hwm:B, 5hwm:C, 5hwm:D, 5hwn:A, 5hwn:C, 5hwn:D, 4ur8:A, 4ur8:B, 4ur8:C, 4ur8:D |
9 | 5tgy:A | 109 | 39 | 0.1613 | 0.0917 | 0.2564 | 10.0 |