BioLiP

>protein
TKAVTFYEDINYGGAHVHLQPGNYTLSQLNTAKIPNDWMTSLKVPSGWTVDVYENDNFTGTKWTYTSDTPWVGNDANDKM
TSVKIYS

The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3so1:H	89	87	0.9540	0.9326	0.9540	1.42e-57	5ht8:A, 3i9h:A, 3i9h:B, 3i9h:C, 3i9h:D, 3i9h:E, 3i9h:F, 3i9h:G, 3i9h:H, 3iaj:A, 3sny:A, 3snz:A, 3so0:A, 3so0:B, 3so0:C, 3so0:D, 3so0:E, 3so0:F, 3so0:G, 3so1:A, 3so1:B, 3so1:C, 3so1:D, 3so1:E, 3so1:F, 3so1:G
2	3hzb:D	90	85	0.3218	0.3111	0.3294	5.85e-14	3hzb:A, 3hzb:B, 3hzb:C, 3hzb:E, 3hzb:F, 3hzb:G, 3hzb:H
3	1prr:A	173	84	0.3103	0.1561	0.3214	2.14e-11	1nps:A, 1prs:A
4	1prr:A	173	84	0.3448	0.1734	0.3571	2.12e-10	1nps:A, 1prs:A
5	2k1w:A	85	38	0.2069	0.2118	0.4737	4.83e-05	5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D
6	2k1w:A	85	38	0.1954	0.2000	0.4474	0.001	5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D
7	4iok:A	557	53	0.1954	0.0305	0.3208	2.2	1fp7:A, 1fpm:A, 1fpm:B, 4iok:B, 4iol:A, 4iol:B, 4jjz:A, 4jjz:B, 4jki:A, 3qus:A, 3qus:B
8	5znh:A	314	46	0.1494	0.0414	0.2826	3.1	5zsx:A, 5zsz:A
9	6fiy:B	303	32	0.1149	0.0330	0.3125	3.2	6fiy:A, 6fks:A, 6fks:B, 6fkt:A, 6fkt:B, 6fl2:A, 6fl2:B, 6rpd:A, 6rpd:B, 6rpe:A, 6rpe:B, 6rqy:A, 6rqy:B, 6rr1:A, 6rr1:B, 6rr4:A, 6rr4:B, 6rr5:A, 6rr5:B, 6rr6:A, 6rr6:B, 6rr8:A, 6rr8:B
10	6sli:A	482	15	0.1034	0.0187	0.6000	3.5	5cx8:A, 5cx8:B, 6sli:C, 6sli:F, 6sli:I, 6slj:D, 6slj:C, 6sln:C, 6sln:D, 6sm3:A, 6smq:A
11	8g27:I	720	24	0.0920	0.0111	0.3333	3.7	8g27:C, 8g27:D, 8g2j:C, 8g2j:D, 8g2j:I, 6wlb:A, 6wlb:C, 6wlb:B
12	5nmx:D	409	38	0.1379	0.0293	0.3158	6.4	5nmw:A, 5nmw:B, 5nmw:C, 5nmw:D, 5nmx:A, 5nmx:B, 5nmx:C

[Back]