TKAKFQSYNYPNMYIRHANFDARIDENVTPEMDSQWELVPGLANSGDGYVSIQSVNYPGYYLRHSNYDLSLEKNDGTSLF
AESATFKIVPGLADPSYISFQSYNFPTRYIRHYNYLLRLDEIVTELDRQDATFKIIS
The query sequence (length=137) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3kmv:E | 140 | 137 | 1.0000 | 0.9786 | 1.0000 | 1.35e-100 | 3kmv:A, 3kmv:B, 3kmv:C, 3kmv:D, 3kmv:F, 3kmv:G, 3kmv:H |
2 | 3aki:A | 448 | 134 | 0.5547 | 0.1696 | 0.5672 | 1.91e-45 | 3akg:A, 3akh:A |
3 | 2d43:A | 482 | 114 | 0.3212 | 0.0913 | 0.3860 | 7.52e-16 | 2d44:A, 6sxr:A, 6sxs:AAA, 6sxt:A, 1wd4:A |
4 | 2d43:A | 482 | 116 | 0.2701 | 0.0768 | 0.3190 | 2.63e-08 | 2d44:A, 6sxr:A, 6sxs:AAA, 6sxt:A, 1wd4:A |
5 | 2d43:A | 482 | 84 | 0.1971 | 0.0560 | 0.3214 | 2.52e-04 | 2d44:A, 6sxr:A, 6sxs:AAA, 6sxt:A, 1wd4:A |
6 | 3vzs:B | 249 | 88 | 0.1898 | 0.1044 | 0.2955 | 0.015 | 4n5m:A, 4n5m:B, 4n5n:A, 4n5n:B, 3vzs:A, 3vzs:C, 3vzs:D |
7 | 7vcf:T | 763 | 46 | 0.1241 | 0.0223 | 0.3696 | 1.3 | |
8 | 7rh8:A | 212 | 44 | 0.1095 | 0.0708 | 0.3409 | 2.7 | |
9 | 7xqp:9 | 225 | 84 | 0.1752 | 0.1067 | 0.2857 | 5.8 | 8htu:9 |
10 | 5xx1:G | 735 | 33 | 0.0876 | 0.0163 | 0.3636 | 6.7 | 5xx1:B, 5xx1:C, 5xx1:D, 5xx1:E, 5xx1:F, 5xx1:H, 5xx1:I |