TIQQNKDTLSQIVVFPTGNYDKNEANAMVNRLANIDGKYLNALKQNNLKIKLLSGKLTDEKEYAYLKGVVPKGWEGTGKT
The query sequence (length=191) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
6r4z:A |
198 |
191 |
1.0000 |
0.9646 |
1.0000 |
4.89e-142 |
5a0p:A, 5a0p:B, 5a0r:A, 5a0r:B, 5a0s:A, 5a0s:B, 5a0x:A, 5a0x:B, 5n12:A, 5n12:B, 2n6j:A, 6r4w:B, 6r4w:A, 6r4x:B, 6r4x:A, 6r4y:B, 6r4y:A, 6r4z:B, 6r50:B, 6r50:A, 6r51:B, 6r51:A, 6r51:C, 6r52:A, 6r52:B, 6r53:A, 6r53:B, 6r54:A, 6r54:B, 6r55:A, 6r55:B, 6r56:A, 6r56:B, 6r57:A, 6r57:B, 6r58:A, 6r58:B, 6r58:C, 6r58:D, 6r59:A, 6r59:B, 6r5a:A, 6r5a:B, 6r5b:B, 6r5b:A, 6r5c:A, 6r5c:B |
2 |
6fpc:C |
188 |
187 |
0.4712 |
0.4787 |
0.4813 |
3.31e-60 |
6fpc:A, 6fpc:B, 6fpc:D |
3 |
8dqx:C |
330 |
55 |
0.0890 |
0.0515 |
0.3091 |
1.6 |
8dqw:C, 8dqz:C, 8dr0:C, 8dr1:C, 8dr3:C, 8dr4:C, 8dr5:C, 8dr6:C, 8dr7:C, 8fs3:C, 8fs4:C, 8fs5:C, 8fs6:C, 8fs7:C, 8fs8:C, 7sgz:C, 7sh2:C, 7st9:C, 7stb:C, 7ste:C, 1sxj:C, 7tfh:C, 7tfi:C, 7tfj:C, 7tfk:C, 7tfl:C, 7thj:C, 7thv:C, 8thb:C, 8thc:C, 8thd:C, 7ti8:C, 7tib:C, 7tic:C, 7tid:C, 7tku:C, 8tw7:3, 8tw8:3, 8twa:3, 8twb:3, 7u19:C, 7u1a:C, 7u1p:C |
4 |
4v5o:A7 |
104 |
36 |
0.0838 |
0.1538 |
0.4444 |
2.4 |
4bts:A7, 4bts:B7, 4bts:C7, 4bts:D7, 4v5o:B7 |
5 |
2po6:G |
204 |
99 |
0.1571 |
0.1471 |
0.3030 |
3.0 |
3huj:G, 3huj:E, 2po6:C, 3sdx:E, 3sdx:G, 6tro:D, 3tzv:G, 6v80:C, 6v80:H, 3vwj:C, 3vwk:C |
6 |
6xs8:A |
184 |
42 |
0.0681 |
0.0707 |
0.3095 |
6.7 |
|
7 |
1r6n:A |
196 |
85 |
0.1204 |
0.1173 |
0.2706 |
8.6 |
|
8 |
6e9n:A |
409 |
50 |
0.0890 |
0.0416 |
0.3400 |
9.7 |
6e9o:B, 6e9o:A |