BioLiP

>protein
THSEREKRVSNAVEFLLDSRVRRTPTSSKVHFLKSKGLSAEEICEAFTKVGQPKTLNEIKRILS

The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6s6r:A	69	64	1.0000	0.9275	1.0000	1.37e-41	5l87:A, 5l8a:A, 5l8a:B, 5l8a:C, 5l8a:D, 5n8v:A, 5n8v:B, 5n8v:D, 5n8v:F, 5oml:A, 5oml:D, 5oml:B, 5oml:C, 6rt2:A, 6rt2:D, 6rt2:B, 6rt2:C, 6s7m:A, 6s7m:B, 6s7m:C, 6s7m:D, 6s7m:H, 6s7m:E, 6spt:A
2	7qrc:B	61	59	0.5781	0.6066	0.6271	1.87e-21	7qrc:A
3	4bxu:A	69	47	0.3594	0.3333	0.4894	1.73e-09	2w84:A, 2w85:A
4	3ff5:A	54	45	0.3438	0.4074	0.4889	1.33e-08	3ff5:B
5	1v1m:A	372	64	0.2656	0.0457	0.2656	4.0	2bfb:A, 2bfc:A, 1olu:A, 1v11:A, 1v16:A, 1x7w:A, 1x7x:A, 1x7y:A, 1x80:A
6	3o7j:A	166	37	0.1875	0.0723	0.3243	5.0
7	2gm3:A	153	21	0.1562	0.0654	0.4762	6.1	2gm3:B, 2gm3:C, 2gm3:D, 2gm3:E, 2gm3:F
8	2oso:A	157	36	0.2500	0.1019	0.4444	6.4	2osd:A
9	5x8p:v	190	31	0.1875	0.0632	0.3871	6.5	5mmj:v, 5mmm:v, 5x8r:v
10	6ysl:E	255	32	0.1562	0.0392	0.3125	8.8	6ysl:D, 6ysl:G, 6ysl:F, 6ysl:C
11	6jq8:A	225	25	0.1250	0.0356	0.3200	9.0
12	8v8p:A	211	27	0.1719	0.0521	0.4074	9.6	8v8p:B, 8v8p:C, 8v8p:D
13	4obv:C	471	36	0.2188	0.0297	0.3889	9.9	4obu:E, 4obu:A, 4obu:U, 4obu:G, 4obu:H, 4obu:F, 4obu:B, 4obu:C, 4obv:D, 4obv:B, 4obv:A

[Back]