THINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKV
EVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSGGKDFK
The query sequence (length=150) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4pyd:C | 154 | 152 | 1.0000 | 0.9740 | 0.9868 | 1.43e-107 | 4pya:A, 4pyd:A, 4pyd:B, 4pyd:E, 4pyd:D, 4pyd:F |
2 | 3jqj:B | 149 | 142 | 0.5133 | 0.5168 | 0.5423 | 2.57e-44 | 3jqj:A, 3jqj:C, 3jqj:D, 3jqj:E, 3jqj:F, 3jqj:G, 3jqj:H, 3jqj:K, 3jqj:I, 3jqj:J, 3jqj:L, 3jqk:A, 3jqm:A, 3jqm:B, 3jqm:E, 3jqm:C, 3jqm:G, 3jqm:D, 3jqm:F, 3jqm:H, 3jqm:I |
3 | 4aso:A | 93 | 41 | 0.1000 | 0.1613 | 0.3659 | 0.38 | 4aso:B, 4aso:D, 4aso:E, 4aso:F, 4aso:G, 4aso:H, 4aso:I, 4aso:K, 4aso:J, 4aso:L, 4aso:M, 4aso:N, 4aso:O, 4aso:P, 4ass:E, 4ass:F, 4ass:G, 4ass:H |
4 | 8y6o:X | 131 | 62 | 0.1133 | 0.1298 | 0.2742 | 3.1 |