BioLiP

>protein
TGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIW
DSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANMDN
FFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQG

The query sequence (length=212) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1q23:B	217	212	1.0000	0.9770	1.0000	4.01e-164	1q23:A, 1q23:C, 1q23:D, 1q23:E, 1q23:F, 1q23:G, 1q23:H, 1q23:I, 1q23:J, 1q23:K, 1q23:L, 3u9f:A, 3u9f:B, 3u9f:C, 3u9f:D, 3u9f:E, 3u9f:F, 3u9f:G, 3u9f:H, 3u9f:I, 3u9f:J, 3u9f:K, 3u9f:L, 3u9f:M, 3u9f:N, 3u9f:O, 3u9f:P, 3u9f:R, 3u9f:S
2	1cia:A	213	208	0.4575	0.4554	0.4663	1.94e-70	1cla:A, 2cla:A, 3cla:A, 4cla:A, 1qca:A, 6x7q:A, 6x7q:B, 6x7q:C
3	6pqx:A	480	94	0.0943	0.0417	0.2128	0.16	6pqx:E, 6pr5:A, 6pr5:E
4	6pqr:A	468	94	0.0943	0.0427	0.2128	0.18	6pqn:A, 6pqn:B, 6pqr:D, 6pqu:A, 6pqu:E, 6pqy:A, 6pqy:D
5	8q5u:D	788	49	0.0849	0.0228	0.3673	1.5	6e58:A, 6e58:B, 6mds:A, 6mds:B, 6mdv:A, 6mdv:B, 8q5u:F, 8q5u:E
6	6int:A	413	152	0.1840	0.0944	0.2566	2.4	6int:B, 6int:C, 6int:D, 6int:E, 6int:F, 6int:G, 6int:H
7	5hmc:A	125	57	0.0708	0.1200	0.2632	6.4
8	2j87:D	171	64	0.0802	0.0994	0.2656	6.7	2j87:A, 2j87:B, 2j87:C
9	7eu1:A	1065	37	0.0660	0.0131	0.3784	7.7
10	8xme:A	1176	37	0.0660	0.0119	0.3784	7.8	7eu0:A, 8xmb:A, 8xmc:A, 8xmd:A
11	5h08:A	282	60	0.1038	0.0780	0.3667	9.2

[Back]