TGSVPLPERLLHHWPNGTWVENIAVRPNGNLLLTTSTPNGTVWHVKKPWTDTPEVELAYNFDEWVDRLIGIGETTPDKYI
VVGSRFYSPDAYSSHVDRTFAAMELDFTKEPPSTRMVAWMPEAELLQGVAALPWDRSIVLISDQYVLRPRYKQVDWTPSP
GQIWRLDTKTGDYELVMTDYAEMNTTYAHGPDVGINGIRILGNELYWVNQDNGGVYRVEIQKNGHPVPPAVPEVVSVVES
QLWDDFAFGPGDEDLLWVTGLNAVYAVSKKNGTAVVVDGVGTSNNMSFPGPTSCQFGRTKHDSNVLYVTGNLYSVPDSLL
DVKIGGWVRAIDTTGFHL
The query sequence (length=338) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7x36:A | 340 | 338 | 1.0000 | 0.9941 | 1.0000 | 0.0 | 7x36:B, 7x36:C, 7x36:D |
2 | 7x2n:A | 340 | 341 | 0.6450 | 0.6412 | 0.6393 | 1.69e-161 | 7x2s:A, 7x2x:A |
3 | 3n3t:B | 261 | 55 | 0.0444 | 0.0575 | 0.2727 | 0.84 | 3n3t:A, 2r6o:A, 2r6o:B |
4 | 6vft:C | 420 | 39 | 0.0385 | 0.0310 | 0.3333 | 2.4 | 6vft:A, 6vft:B, 6vft:D |
5 | 2yik:A | 493 | 32 | 0.0385 | 0.0264 | 0.4062 | 2.9 | |
6 | 6j6g:d | 566 | 119 | 0.0740 | 0.0442 | 0.2101 | 3.6 | 7b9v:S, 6j6h:d, 6j6n:d, 6j6q:d, 5lqw:R |
7 | 1iun:B | 276 | 114 | 0.1006 | 0.1232 | 0.2982 | 3.6 | 2d0d:A, 1iuo:A, 1iup:A, 1uk7:A, 1uk8:A, 1uk9:A, 1uka:A |
8 | 8ghh:A | 276 | 68 | 0.0533 | 0.0652 | 0.2647 | 4.8 | 8ghi:A |
9 | 4l8f:D | 287 | 40 | 0.0414 | 0.0488 | 0.3500 | 6.3 | 4l8f:B, 4l8w:I, 4l8w:G |