TFNDIEARLAAVLEEAFEAGTSIYNERGFKRRIGYGNRPAVIHIDLANAWTQPGHPFSCPGMETIIPNVQRINEAARAKG
VPVFYTTNVYRNRDASSGTNDMGLWYSKIPTETLPADSYWAQIDDRIAPADGEVVIEKNRASAFPGTNLELFLTSNRIDT
LIVTGATAAGCVRHTVEDAIAKGFRPIIPRETIGDRVPGVVQWNLYDIDNKFGDVESTDSVVQYLDALPQFEDTVPKTLS
DPQPEVEAPADPV
The query sequence (length=253) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1nba:A | 253 | 253 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 1nba:B, 1nba:C, 1nba:D |
2 | 3eef:A | 173 | 160 | 0.1858 | 0.2717 | 0.2938 | 9.61e-18 | 3eef:B |
3 | 8bkd:F | 224 | 209 | 0.2055 | 0.2321 | 0.2488 | 6.33e-11 | 8bkd:C, 8bkd:D, 8bkd:G, 8bkd:H, 8bkd:J, 8bkd:K, 8bkd:L |
4 | 2fq1:A | 279 | 141 | 0.1581 | 0.1434 | 0.2837 | 6.98e-10 | |
5 | 6a8l:A | 183 | 78 | 0.1186 | 0.1639 | 0.3846 | 1.73e-09 | 6a8l:B, 5zn8:A, 5zn8:B |
6 | 3tb4:A | 205 | 155 | 0.1660 | 0.2049 | 0.2710 | 1.06e-07 | 3tg2:A |
7 | 6azq:G | 226 | 139 | 0.1502 | 0.1681 | 0.2734 | 3.83e-07 | 6azq:H, 6azq:A, 6azq:B, 6azq:C, 6azq:D, 6azq:E, 6azs:B, 6azs:D |
8 | 6xje:B | 220 | 176 | 0.1739 | 0.2000 | 0.2500 | 1.55e-06 | 6xj4:B, 6xje:A, 6xje:C, 6xje:D |
9 | 3o93:A | 190 | 169 | 0.1542 | 0.2053 | 0.2308 | 1.99e-06 | 3o90:A, 3o90:B, 3o90:C, 3o90:D, 3o91:A, 3o91:B, 3o91:C, 3o91:D, 3o92:A, 3o92:B, 3o92:C, 3o92:D, 3o93:B, 3o93:C, 3o93:D, 3o94:A, 3o94:B, 3o94:C, 3o94:D |
10 | 3s2s:A | 182 | 78 | 0.0949 | 0.1319 | 0.3077 | 2.23e-06 | 3s2s:B, 3s2s:C, 3s2s:D |
11 | 6xjm:D | 230 | 136 | 0.1581 | 0.1739 | 0.2941 | 5.64e-05 | 6xjm:A, 6xjm:B, 6xjm:C |
12 | 1im5:A | 179 | 154 | 0.1344 | 0.1899 | 0.2208 | 1.89e-04 | |
13 | 3r77:B | 206 | 133 | 0.1423 | 0.1748 | 0.2707 | 2.52e-04 | 3r77:A |
14 | 8cib:D | 196 | 127 | 0.1462 | 0.1888 | 0.2913 | 7.68e-04 | 8cib:F |
15 | 6kua:A | 163 | 78 | 0.0870 | 0.1350 | 0.2821 | 0.002 | |
16 | 5hwg:A | 175 | 148 | 0.1621 | 0.2343 | 0.2770 | 0.002 | 5hwh:A |
17 | 2wta:A | 212 | 176 | 0.1739 | 0.2075 | 0.2500 | 0.16 | 2wt9:A, 2wt9:B |
18 | 1nf8:A | 207 | 159 | 0.1344 | 0.1643 | 0.2138 | 0.47 | |
19 | 5xgd:A | 548 | 103 | 0.0830 | 0.0383 | 0.2039 | 0.52 | 8pps:A, 8pps:B, 5xge:A |
20 | 6iuy:A | 585 | 70 | 0.0672 | 0.0291 | 0.2429 | 2.0 | 6iuy:B |
21 | 4ifd:J | 948 | 81 | 0.1028 | 0.0274 | 0.3210 | 2.6 | 5c0x:J, 5jea:J, 2vnu:D |
22 | 3pl1:A | 185 | 39 | 0.0593 | 0.0811 | 0.3846 | 6.9 | |
23 | 5wou:A | 95 | 44 | 0.0514 | 0.1368 | 0.2955 | 7.4 | |
24 | 4bfn:A | 106 | 80 | 0.0711 | 0.1698 | 0.2250 | 7.5 | 4bfo:A, 2v8l:A, 2v8m:A, 2v8m:B, 2v8m:C, 2v8m:D |
25 | 7k0a:A | 196 | 56 | 0.0751 | 0.0969 | 0.3393 | 9.2 | 7k09:A, 7k09:B, 7k09:C, 7k09:D, 7k09:E, 7k09:F, 7k0a:B |