TFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDG
QRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPD
The query sequence (length=120) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1o7k:A | 124 | 120 | 1.0000 | 0.9677 | 1.0000 | 9.09e-89 | 1o7k:B, 1o7k:C |
2 | 7bi2:A | 1021 | 114 | 0.2417 | 0.0284 | 0.2544 | 8.83e-07 | |
3 | 1h6h:A | 143 | 93 | 0.2417 | 0.2028 | 0.3118 | 1.39e-04 | |
4 | 1nlf:B | 254 | 28 | 0.1167 | 0.0551 | 0.5000 | 0.43 | |
5 | 2hd0:G | 127 | 42 | 0.1000 | 0.0945 | 0.2857 | 3.0 | |
6 | 6sbq:A | 891 | 60 | 0.1667 | 0.0224 | 0.3333 | 4.5 | 6ea1:A, 6ea2:A, 6eaa:A, 6eab:A, 3ebg:A, 3ebh:A, 3ebi:A, 6ee3:A, 6ee4:A, 6ee6:A, 6eed:A, 8ewz:A, 8ex3:A, 8eyd:A, 8eye:A, 8eyf:A, 8ez2:A, 4j3b:A, 4k5l:A, 4k5m:A, 4k5n:A, 4k5o:A, 4k5p:A, 3q43:A, 3q44:A, 4r5t:A, 4r5v:A, 4r5x:A, 6sbr:A, 8slo:A, 8svl:A, 8t6h:A, 8t7p:A, 3t8v:A, 8t83:A, 4x2u:A, 5xm7:A, 5y19:A, 5y1h:A, 5y1k:A, 5y1q:A, 5y1r:A, 5y1s:A, 5y1t:A, 5y1v:A, 5y1w:A, 5y1x:A, 5y3i:A, 4zqt:A, 4zw3:A, 4zw5:A, 4zw6:A, 4zw7:A, 4zw8:A, 4zx3:A, 4zx4:A, 4zx5:A, 4zx6:A |
7 | 4n78:A | 1184 | 35 | 0.1167 | 0.0118 | 0.4000 | 7.7 |