TEQIQKRTAAIQKRIAAIQKRIYAMTASAGAGMSIEEITKQIAAIQLRIVGDQVQIAYQTASMSTEEIQKQIAAIETQIC
KIEAAIELKEAGITSDFYFELINKAKTCEGVEALKEHILAAHT
The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6zie:A | 123 | 123 | 1.0000 | 1.0000 | 1.0000 | 1.41e-82 | |
2 | 3tr9:A | 277 | 28 | 0.0732 | 0.0325 | 0.3214 | 0.90 | 3tr9:B, 3tr9:C, 3tr9:D |
3 | 3u4c:A | 254 | 42 | 0.1301 | 0.0630 | 0.3810 | 0.96 | |
4 | 4kcf:A | 407 | 66 | 0.1220 | 0.0369 | 0.2273 | 1.1 | 3m9v:A |
5 | 2f02:A | 319 | 81 | 0.2033 | 0.0784 | 0.3086 | 1.4 | 2f02:B |
6 | 8bx8:C | 3947 | 90 | 0.2033 | 0.0063 | 0.2778 | 5.6 | 7k58:C, 7k5b:C, 7kek:C |
7 | 6jla:C | 184 | 79 | 0.2033 | 0.1359 | 0.3165 | 9.0 |