BioLiP

>protein
TENFFGKTLAARPVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWD
KYISVADGGKVLGTWVDLREGETFGNTYQTVIDASKSIFVPRGVANGFQVLSDFVAYSYLVNDYWALELKPKYAFVNYAD
PSLDIKWENLEEAEVSEADENHPFLKDVKPLRKEDL

The query sequence (length=196) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2ixl:C	197	196	1.0000	0.9949	1.0000	3.67e-145	2ixl:A, 2ixl:B, 2ixl:D, 1nyw:A, 1nyw:B, 1nzc:A, 1nzc:B, 1nzc:C, 1nzc:D
2	6ndr:A	188	161	0.2857	0.2979	0.3478	1.89e-18	6ndr:B
3	6c46:A	183	167	0.3061	0.3279	0.3593	5.30e-18	6c46:D
4	2ixh:A	184	177	0.3112	0.3315	0.3446	6.88e-18	2ixh:B, 2ixi:B, 2ixi:A, 2ixk:A, 2ixk:B
5	1dzt:A	183	177	0.2755	0.2951	0.3051	7.56e-14	1dzt:B
6	2ixc:A	198	186	0.3061	0.3030	0.3226	2.12e-12	2ixc:B, 2ixc:C, 2ixc:D
7	1epz:A	183	187	0.2806	0.3005	0.2941	3.72e-12
8	7pwh:AAA	203	167	0.2500	0.2414	0.2934	4.05e-11
9	7pvi:AAA	199	198	0.3061	0.3015	0.3030	7.33e-11	7pvi:BBB, 7pwb:AAA, 7pwb:BBB
10	3ryk:A	175	165	0.2602	0.2914	0.3091	1.34e-10	3ryk:B
11	4hn1:C	201	172	0.2602	0.2537	0.2965	1.46e-09	4hmz:A, 4hmz:B, 4hmz:C, 4hmz:D, 4hn1:A, 4hn1:B, 4hn1:D
12	1oi6:A	202	173	0.2449	0.2376	0.2775	4.64e-08	1oi6:B
13	5buv:A	174	125	0.1684	0.1897	0.2640	6.53e-06	5buv:B
14	8dcl:A	185	101	0.1429	0.1514	0.2772	0.009	7anj:A, 7anj:B, 8dak:A, 8dak:B, 8dcl:B
15	2xzl:A	756	42	0.0714	0.0185	0.3333	2.7
16	5xj2:A	454	72	0.0969	0.0419	0.2639	3.0	5xj2:B, 5xj2:C, 5xj2:D, 5zq0:A, 5zq1:A, 5zq8:B, 5zq8:A, 5zth:A
17	6w54:A	221	84	0.1327	0.1176	0.3095	3.6
18	5chi:A	230	46	0.0765	0.0652	0.3261	4.5	5chi:B, 5chi:C
19	7ned:A	545	83	0.1020	0.0367	0.2410	8.3
20	3vfq:A	375	29	0.0663	0.0347	0.4483	9.6	4d86:A, 5o2d:A, 3q6z:A, 3q71:A

[Back]