TEEEQIEKDLQGLQEKQRLNVKRERRRKNEMKQKELQRMQMNMESLFNLKTAEKTGILNDLAKGKKRMIFTMIKDKDSAA
DADDLESELNAMYSDYKTRRSERDAKFRAKQARAITNLISKLKGQEGDHKLSSKARMIFNDPIFNNVEPFDSDYDSEEEK
NQTKKEKHSRDENLPDWFLEDAMNARPIK
The query sequence (length=189) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7nad:w | 328 | 190 | 1.0000 | 0.5762 | 0.9947 | 1.13e-133 | 7r72:w |
2 | 7nac:w | 672 | 271 | 1.0000 | 0.2812 | 0.6974 | 1.27e-112 | 7naf:w, 7r6k:w, 7r7a:w, 7r7o:A, 7r7o:B |
3 | 8v87:w | 280 | 208 | 0.7725 | 0.5214 | 0.7019 | 1.19e-92 | |
4 | 7u0h:w | 321 | 110 | 0.4497 | 0.2648 | 0.7727 | 8.25e-45 | |
5 | 8ia0:CS | 629 | 225 | 0.4339 | 0.1304 | 0.3644 | 9.84e-14 | 8i9w:CS, 8i9x:CS, 8i9y:CS, 8i9z:CS |
6 | 7r6q:w | 68 | 110 | 0.2646 | 0.7353 | 0.4545 | 6.87e-10 | |
7 | 8esq:w | 504 | 147 | 0.2169 | 0.0813 | 0.2789 | 2.06e-05 | 8esr:w |
8 | 6elz:w | 436 | 96 | 0.1799 | 0.0780 | 0.3542 | 3.28e-05 | 6em5:w |
9 | 8etc:w | 420 | 103 | 0.1587 | 0.0714 | 0.2913 | 7.78e-05 | |
10 | 7ohr:w | 198 | 64 | 0.1376 | 0.1313 | 0.4062 | 2.62e-04 | |
11 | 6ylx:w | 360 | 10 | 0.0529 | 0.0278 | 1.0000 | 2.2 | |
12 | 3vti:C | 305 | 35 | 0.0635 | 0.0393 | 0.3429 | 3.0 | 3vti:D |
13 | 8pnt:A | 749 | 41 | 0.0688 | 0.0174 | 0.3171 | 3.1 | 8by6:A, 6d0y:C, 1n52:A, 5oo6:D, 5oo6:G, 5oo6:J, 5oo6:M, 5oo6:P, 5oob:I, 5oob:A, 8pmp:A |
14 | 7ohv:w | 69 | 14 | 0.0476 | 0.1304 | 0.6429 | 3.2 |