TEEDNISQLWGLYEMSREKLENDDIDASVSLVFGTIHEADRILRNTEDISTLPKDFHAAYSSALLAVSELFEIAQKRLKE
TNTEESYIDAAIERAQLGLDAPGNESRLFLALARAYLEKVRVLVWRHDNEESLANIPVTQLVNPYIEKAIQYLRPLAQDS
TEYFDALTPDSLRPLYILSSYLFQFGDQFSEAFLLDVCSIITALWLKSVVDPNTPAYYKLIAQEAVLNNYTTFAEYYMDL
LDNVDDLINKASSWLNNSVDTWNVIYTLDKSPERLLKLADIKMDLAQIVQDEASQDNYLKEACNAIKEAQGSGVELSPDY
VEFVEAYS
The query sequence (length=328) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3qtm:A | 329 | 327 | 0.9970 | 0.9939 | 1.0000 | 0.0 | 3qtm:B |
2 | 4v6w:Az | 837 | 67 | 0.0640 | 0.0251 | 0.3134 | 0.43 | |
3 | 2yc3:A | 219 | 74 | 0.0762 | 0.1142 | 0.3378 | 0.57 | 5mrm:A, 5mro:A, 5mrp:A, 4nak:A, 4nal:A, 4nan:A, 1w77:A, 2yc5:A, 2ycm:A |
4 | 8h4r:A | 287 | 30 | 0.0457 | 0.0523 | 0.5000 | 0.58 | |
5 | 5bxy:A | 155 | 50 | 0.0488 | 0.1032 | 0.3200 | 1.5 | 5bxy:B |
6 | 7ezt:B | 727 | 50 | 0.0579 | 0.0261 | 0.3800 | 2.5 | |
7 | 5hzg:A | 257 | 72 | 0.0640 | 0.0817 | 0.2917 | 2.9 | 5hzg:E |
8 | 7ulz:A | 521 | 88 | 0.0640 | 0.0403 | 0.2386 | 7.0 | |
9 | 8buu:9 | 573 | 35 | 0.0427 | 0.0244 | 0.4000 | 7.1 |