TEDEIRKLRKLLEEAEKKLYKLEDKTRRSEEISKTDDDPKAQSLQLIAESLMLIAESLLIIAISLLLSS
The query sequence (length=69) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6tj1:A | 71 | 56 | 0.7681 | 0.7465 | 0.9464 | 9.92e-28 | 6tms:D, 6tms:J |
2 | 3k6j:A | 430 | 49 | 0.2174 | 0.0349 | 0.3061 | 0.84 | |
3 | 7sqc:1B | 1660 | 55 | 0.2319 | 0.0096 | 0.2909 | 1.2 | |
4 | 7aia:AAA | 259 | 60 | 0.2899 | 0.0772 | 0.3333 | 1.5 | |
5 | 6gk5:A | 403 | 45 | 0.1884 | 0.0323 | 0.2889 | 4.6 | 6gk6:A |
6 | 4yp9:B | 342 | 32 | 0.1739 | 0.0351 | 0.3750 | 6.4 | 2hj9:A, 2hj9:B, 1jx6:A, 4yp9:A, 4yr7:A, 4yr7:B, 4yrz:A, 4yrz:B |
7 | 7cce:A | 159 | 18 | 0.1449 | 0.0629 | 0.5556 | 8.0 | |
8 | 7nyw:B | 858 | 35 | 0.2029 | 0.0163 | 0.4000 | 8.7 | |
9 | 7zlt:C | 415 | 44 | 0.1739 | 0.0289 | 0.2727 | 9.6 | 3ivy:A, 3iw0:A, 3iw1:A, 3iw2:A, 7qke:A, 7qnn:A, 7qwn:A, 7qwn:B, 7qwn:C, 7r1i:A, 7r1i:B, 7r1i:C, 7r3u:A, 7r3u:B, 7r3u:C, 2x5l:A, 2x5w:A, 2xc3:A, 2xn8:A, 7yxf:A, 7yxf:B, 7yxf:C, 7zgl:A, 7zgl:B, 7zgl:C, 7zic:A, 7zic:B, 7zic:C, 7zlt:A, 7zlt:B, 7zlz:A, 7zlz:B, 7zlz:C, 7zqr:A, 7zqr:B, 7zqr:C, 7zsu:A, 7zsu:B, 7zsu:C, 7zt0:A, 7zt0:B, 7zxd:A, 7zxd:B, 7zxd:C |
10 | 5n1q:A | 549 | 23 | 0.1304 | 0.0164 | 0.3913 | 9.6 | 5n1q:D, 5n28:A, 5n28:D, 5n2a:A |