TEADPAILSRRQKQIDYGKNTAATPNKYGKYSRRAFDGMVKIWRKSM
The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4tv0:A | 47 | 47 | 1.0000 | 1.0000 | 1.0000 | 2.70e-30 | |
2 | 4tuw:A | 71 | 63 | 0.9362 | 0.6197 | 0.6984 | 3.22e-24 | 4tuw:B, 4tux:B, 4tux:A |
3 | 4qoz:C | 73 | 66 | 0.5745 | 0.3699 | 0.4091 | 1.40e-11 | 4l8r:C |
4 | 2p0j:A | 203 | 28 | 0.2553 | 0.0591 | 0.4286 | 1.9 | 2p0j:B, 1vrr:A, 1vrr:B |
5 | 5ulj:B | 386 | 36 | 0.2766 | 0.0337 | 0.3611 | 1.9 | 5ulj:A |
6 | 7wm6:A | 240 | 39 | 0.2766 | 0.0542 | 0.3333 | 2.3 | 7wm6:C, 7wm6:D |
7 | 3vte:A | 502 | 49 | 0.2979 | 0.0279 | 0.2857 | 2.8 | |
8 | 6j9f:D | 1215 | 18 | 0.2128 | 0.0082 | 0.5556 | 3.3 | 6j9e:D |
9 | 4krh:A | 430 | 41 | 0.2553 | 0.0279 | 0.2927 | 5.1 | 4krh:B, 4kri:A, 4kri:B, 4kri:C |
10 | 6iqy:A | 536 | 22 | 0.2340 | 0.0205 | 0.5000 | 5.3 | 3abg:A, 3abg:B, 6i3j:A, 6i3j:B, 6i3k:A, 6i3k:B, 6i3l:A, 6i3l:B, 6iqx:A, 6iqx:B, 6iqy:B, 6iqz:A, 2xll:A, 2xll:B, 2xll:C, 2xll:D |
11 | 8i0w:L | 419 | 33 | 0.1915 | 0.0215 | 0.2727 | 5.8 | 5yzg:L |
12 | 6icz:L | 454 | 29 | 0.1915 | 0.0198 | 0.3103 | 7.0 | 5xjc:L |
13 | 7mfm:I | 490 | 18 | 0.1702 | 0.0163 | 0.4444 | 7.2 | 7mfm:J, 7mft:I |
14 | 6id0:L | 475 | 29 | 0.1915 | 0.0189 | 0.3103 | 7.6 | 6id1:L |
15 | 3j7a:S | 128 | 32 | 0.2340 | 0.0859 | 0.3438 | 9.4 | 3jbn:S, 3jbo:S, 3jbp:S, 6okk:S, 8tpu:SS |
16 | 9jd2:A | 273 | 29 | 0.2340 | 0.0403 | 0.3793 | 9.6 | 9jhv:A, 1wta:A |