TDYDKLSNLTFEFPDLTVEIKGPDVVGVNKLAEYEVHVKNLGGIGVPSTKVRVYINGTLYKNWTVSLGPKEEKVLTFNWT
PTQEGMYRINATVDEENTVVELNENNNVATFDVSVV
The query sequence (length=116) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3idu:A | 116 | 116 | 1.0000 | 1.0000 | 1.0000 | 1.47e-80 | 3idu:B |
2 | 3o01:A | 283 | 74 | 0.1379 | 0.0565 | 0.2162 | 0.69 | 3o01:B, 3o02:A, 3o02:B |
3 | 3zqe:B | 248 | 74 | 0.1379 | 0.0645 | 0.2162 | 0.83 | |
4 | 3zqe:A | 272 | 74 | 0.1379 | 0.0588 | 0.2162 | 0.85 | 7agx:2F, 7agx:2K |
5 | 2m9p:A | 240 | 57 | 0.1379 | 0.0667 | 0.2807 | 1.0 | 2m9q:A |
6 | 4g56:A | 617 | 28 | 0.0948 | 0.0178 | 0.3929 | 2.0 | 4g56:C |
7 | 5twj:C | 157 | 52 | 0.1207 | 0.0892 | 0.2692 | 2.4 | 5twj:D, 5twj:A, 5twj:B, 5twk:C, 5twk:D, 5twk:A, 5twk:B |
8 | 6d50:B | 840 | 33 | 0.0862 | 0.0119 | 0.3030 | 3.8 | 6d50:A, 6nzg:A, 6nzg:B, 5uj6:A, 5uj6:B |
9 | 7swl:E | 480 | 31 | 0.1293 | 0.0312 | 0.4839 | 5.4 | |
10 | 6o9n:A | 613 | 56 | 0.1207 | 0.0228 | 0.2500 | 8.1 | 6o9n:B |
11 | 4wei:A | 259 | 64 | 0.1552 | 0.0695 | 0.2812 | 9.4 | |
12 | 4ysb:A | 225 | 43 | 0.1293 | 0.0667 | 0.3488 | 9.8 | 4ysb:B |